KEGG   Rhodococcus opacus: ROP_60280Help
Entry
ROP_60280         CDS       T00882                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rop  Rhodococcus opacus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rop00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6590603..6591502
Genome map
AA seq 299 aa AA seqDB search
MADRDVPPAPDRPSSTLCGRPVAVDRALVMAIVNRTPDSFYDRGATFTDSAAMAAVERAV
DEGADLVDIGGVKAGPGDVVDSAEEIRRVVPFVAAIRGRYPELLVSVDTWRADVARLAVA
EGADLINDTWAGADPALVEVAAETGAGIVCSHTGGAVPRTRPFRVRYSDVVADVLEEVVA
AAENAARLGVPADSILIDPTHDFGKNTYHGLELLRRVEDLVNTGWPVLMALSNKDFVGET
LGVDLVERLEGTLAATAMAAAGGARVFRVHEVAPTRRVVDMVAAIQGRRAPSRTVRGLA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagagacgtaccgcccgcgcccgaccgtccgtcctccacgctgtgcggacgg
cctgtggcggtcgaccgcgcgctggtgatggccatcgtgaaccggacacccgattcgttc
tacgaccgcggtgccacgttcaccgactccgcggccatggcggcggtcgagcgggccgtg
gacgagggtgccgacctcgtcgacatcggcggcgtgaaggccggtccgggcgacgtcgtc
gactcggcggaggagatccggcgggtggtgccgttcgtcgccgcgatccgcgggcgctat
cccgagttgctcgtcagcgtcgacacctggcgcgccgacgtggcccggctggccgtcgcc
gagggcgccgacctgatcaacgacacgtgggccggcgccgacccggcgctcgtcgaggtg
gccgcggagacgggtgccggcatcgtctgttcgcacaccgggggagcggtcccccggacc
cggccgttccgtgtccgctactccgacgtcgtcgcggacgtcctcgaggaagtggtggcg
gccgccgagaacgcggcccggctgggggtgcccgccgactcgatcctcatcgatccgacc
cacgatttcgggaaaaacacctatcacgggctcgagttgttgcggcgagtggaagatctt
gtaaatacgggatggccagtgctcatggcgctgagcaacaaggacttcgtcggggagact
ctaggggtagatctcgtcgagcggttggagggaacattggcagcgacagctatggccgcc
gcaggaggcgcccgagtcttccgtgtccacgaagttgcccccacgcgtcgagtggtggac
atggtggccgcgatccagggccggcgcgccccgtcccgcaccgtgcgggggctggcatga

DBGET integrated database retrieval system