KEGG   Rhodococcus opacus B4: ROP_63060Help
Entry
ROP_63060         CDS       T00882                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rop  Rhodococcus opacus B4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_63060 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_63060 (sdhD)
   00650 Butanoate metabolism
    ROP_63060 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ROP_63060 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6912751..6913194)
Genome map
AA seq 147 aa AA seqDB search
MTTEAKSLGKTYDRPASLDNPRSPRRTSKNNFELYAWLFMRFSGLALIFLVLGHLFIMLM
LDDGVHRINFAFVAGRWSSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLTT
ILVLSMILIMGLGTYVIFTFDPNISAS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaagccaagagtctcggcaagacctacgaccgtcccgccagcctggacaat
ccgcgctctccgcgccggacctcgaagaacaacttcgagctgtacgcctggctgttcatg
cggttctccggtctcgcactgatcttcctggtgctcggccacctcttcatcatgctgatg
ctcgacgacggcgtgcaccgcatcaacttcgcgttcgtcgcgggccgctggtccagcccg
ttctggcagttctgggacctcaccatgctgtggcttgcccagctgcacggcggaaacgga
ctccgcacggtcatcgcggactactcccgcaaggactccacgcgcttctggctgaccacg
atcctcgttctctcgatgatcctgatcatgggcctcggcacgtacgtcatcttcaccttc
gaccccaatatctcggcgagctag

DBGET integrated database retrieval system