KEGG   Rhodococcus opacus B4: ROP_63090Help
Entry
ROP_63090         CDS       T00882                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rop  Rhodococcus opacus B4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ROP_63090 (deoA)
Enzymes [BR:rop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ROP_63090 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6914253..6915548
Genome map
AA seq 431 aa AA seqDB search
MHDASSIIAAKRDGRELSGAEIDWVVEAFTRGVVADEQMSALAMAIFFRGMTRGEVSRWT
TAMISSGHRLDFTHLGRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGG
TLDKLESIPGWRADLDTSEMAEILSDPEVGAVVCAAGSDLAPADRRLYALRDVTGTVESI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKKLDDARELAQTMVDLGSDAGVRTMAVLT
AMDAPLGHTAGNALEVRESLEVLAGGGPSDVVELTLALAREMLKAAGIDGVDPADKLRDG
SAMDRWRRMIAAQGGDPYAPLPTARHTEVLLSESDGVVCGLDAMAVGLAAWRLGAGRARQ
GEPVQAGAGIELHAKPGETVSVGTPLVTLHTDTPERFAAAKAALSEAWTVVADAPPVTTP
LVIERIEDPSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgcgtcgtcgatcatcgccgccaagcgggacggccgagaattgtccggtgca
gagatcgactgggtggtggaggcattcacccggggcgtcgtggccgacgagcagatgtcg
gctctggcgatggcgatcttcttccgcgggatgacgcgcggggaggtgagccgctggacc
acggcgatgatctcgtccggtcaccgtctcgacttcacacacctcggccgccccaccgtg
gacaagcattcgacgggtggtgtgggcgacaagatcacgcttcccctcgcgccgctggtc
gccgcgtgcggcgccgccgtgccgcagctgtcgggtcgcggcctgggccacaccggtggc
actctcgacaagctcgagtcgatcccggggtggcgcgccgacctcgacacgtcggagatg
gccgagatcctgtccgaccccgaggtcggcgccgtcgtgtgcgccgcgggctcggacctg
gccccggcggaccggcggttgtacgcactgcgggacgtcaccgggaccgtcgagtcgatt
cccctgatcgcgagctcgatcatgagcaagaagatcgccgagggcaccggcgcgctggtc
ctcgacgtgaaggtcggctcgggcgcgttcatgaagaagctcgacgatgcacgcgagttg
gcccagacgatggtcgacctggggagcgacgccggggtgcggacgatggcggtgctcacg
gcgatggacgcgccactcggtcacaccgcgggcaatgcgctggaggtgcgggaatcgctg
gaggtgctcgccgggggcggcccgtccgacgtcgtggaactgacgctcgcgctcgcgcga
gaaatgttgaaggcagccggaatcgacggcgtcgacccggccgacaagctgcgggacggg
tccgccatggaccgctggcggaggatgatcgccgcccagggcggcgacccctacgccccg
ctgccgacggcccggcacaccgaggtgctgctctccgagtcggacggtgtggtgtgcggt
ctcgacgccatggccgtcgggctcgccgcctggcgactcggcgcgggccgcgcgcggcag
ggcgagccggtgcaggcgggggccggcatcgaactgcacgcgaagccgggggagacggtg
tcggtgggcaccccgctcgtcacgctgcacaccgacacgcccgaacggttcgccgcggcg
aaagccgcactttccgaagcctggaccgtcgtggccgacgcgccgccggtgaccacaccg
ctcgtcatcgagcggatcgaggatccctcgcgctaa

DBGET integrated database retrieval system