KEGG   Rhodococcus opacus: ROP_63250Help
Entry
ROP_63250         CDS       T00882                                 

Gene name
glpk
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rop  Rhodococcus opacus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rop00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6929707..6931200)
Genome map
AA seq 497 aa AA seqDB search
MRVIQYIAAIDQGTTSSRCMIFDHDGAVVSVAQKEHEQFFPRAGWVEHDPRQLWINTREV
VASALAKADLTKTDIAAIGITNQRETAVVWDRNTGEPVYNAIVWQDTRTDELCTRLGGDE
GPGRYQKRTGLPLSTYFSGPKVRWILDNVDGAREKAEAGELCFGTIDSWILWHITEGTHV
TDVTNASRTLLMNLETLDWDPEICADFGIPMSMLPEIRSSSEIYGVGRERGTLPGVPVAG
ILGDQQAATFGQACLSEGEAKNTYGTGNFLLLNTGTTPVHSKHGLLTTVCYKIGDAPAVY
ALEGSVAVTGSLVQWLRDNLGIISSAKDIEDLAKSVDDNGGAYFVPAFSGLFAPRWRPDA
RGAIVGLTRFVNKGHLARAALEATAYQTREVIEAMRADSGVELASLKVDGGMVVNETLMQ
FQSDILAVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRANWAVDKTWEPGMDEAEST
RLYAEWNKAVERTYDWA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgattcagtacatcgccgcgatagaccagggcaccacctccagccgctgcatg
atcttcgaccacgacggcgccgtggtgagcgtcgcccagaaggagcacgagcagttcttt
ccgcgcgcaggctgggtggagcacgacccgaggcagctgtggatcaacacccgcgaggtg
gtggcgtccgcgctcgcgaaggccgacctcaccaaaacagacatcgccgcgatcggcatc
accaatcagcgcgagacggcggtcgtgtgggaccggaacacgggagaacccgtgtacaac
gccatcgtctggcaggacacgcgcaccgacgaattgtgcacgcggctcggcggcgacgag
ggcccaggccgctaccagaaacgcaccggcctgccgctgtcgacgtatttctcggggccg
aaggtccgctggatcctcgacaacgtcgacggcgcccgcgagaaggcggaggcgggcgaa
ctctgcttcggcacgatcgacagctggattctgtggcacatcacggagggcacccacgtg
acggatgtcaccaacgcgtcccgcacgctgctcatgaatctcgagaccctcgactgggat
ccggagatctgcgccgatttcggcatcccgatgtcgatgctgccggagatccgcagctcg
tcggagatctacggcgtcggacgcgaacgggggacgctgccgggcgtgcccgtcgcggga
atcctcggcgatcagcaggccgcgacgttcgggcaggcctgcctgtcggaaggcgaagcg
aagaacacgtacgggacgggaaacttcctgctgctcaacacggggaccactcctgtgcac
agcaagcacggcctcctcaccaccgtctgctacaagatcggcgacgcaccggccgtctac
gcactcgagggatccgtggccgtcaccggttcgctggtgcagtggctgcgcgacaacctg
ggaatcatcagttcggcgaaggatatcgaggatctggcgaagtcggtcgacgacaacggc
ggcgcctacttcgtgcccgcgttctccgggttgttcgcaccccgctggcggcccgacgcc
cgcggggcgatcgtcgggctcacccggttcgtgaacaagggccatctcgcgagggccgcc
ctcgaggccaccgcgtaccagacccgcgaggtgatcgaggcgatgcgcgccgattcgggc
gtcgaactcgcctccctgaaggtggacggcggcatggtcgtcaacgagaccctcatgcag
ttccagtcggacattctcgcggtacccgtcatccggcccgtcgtcaacgagacgaccgcg
ctgggcgccgcctatgccgcaggtctggccgtcggcttctgggagagcgaggacgacatc
cgcgcgaactgggccgtcgacaagacctgggagcccgggatggacgaggccgagtccacc
cggctctacgccgagtggaacaaggcggtcgagcggacctacgactgggcgtga

DBGET integrated database retrieval system