KEGG   Rhodococcus opacus B4: ROP_65320Help
Entry
ROP_65320         CDS       T00882                                 

Definition
6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_65320
   01230 Biosynthesis of amino acids
    ROP_65320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_65320
   00030 Pentose phosphate pathway
    ROP_65320
   00051 Fructose and mannose metabolism
    ROP_65320
   00052 Galactose metabolism
    ROP_65320
  Energy metabolism
   00680 Methane metabolism
    ROP_65320
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ROP_65320
Protein phosphatases and associated proteins [BR:rop01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ROP_65320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7144231..7145262
Genome map
AA seq 343 aa AA seqDB search
MRIGMLTGGGDCPGLNAVIRAVVRTAAGRYGSSVVGFRDGWRGLLEDRKVALSNDDRIDR
ILTRGGTILGTARVNPDKLKAGLDQIRQTLDDNGIDALIPIGGEGTLTAASWLAESGVPV
IGVPKTIDNDIDCTDVTFGFDTALSIATDAIDRLHTTAESHQRVMLVEVMGRHAGWIALH
SGLATGAHLTLVPEVPFDVGEVCAMVKKRFQRGDSHFICVVAEGATPTPESMSLREGGID
EFGHKRFTGVAQQLGDEIVRRIGKEVRTTVLGHVQRGGTPTPYDRVLATRFGVHATDAVH
RGDFGNMVALHGTSIDLVPLEEATRRLKTVPRERYDEAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggaatgctcaccggaggcggcgactgccccggactcaacgcggtgatcagg
gcggtggtgcggaccgccgccggtcgatacggcagctcggtggtgggattccgtgacggg
tggcgtggcctgctcgaagaccgcaaggtcgcgctgtccaacgacgaccggatcgaccgg
atcctcacccggggcggcaccatcctcggtaccgcacgggtcaaccccgacaagctgaag
gccggcctcgaccagatccggcagacactcgacgacaacggcatcgacgcgctcatcccg
atcggcggcgagggcacgctgacggcggcgagctggctcgccgagagcggcgttcccgtg
atcggggttccgaagaccatcgacaacgacatcgactgcacggacgtgacgttcggtttc
gacaccgccctgtccatcgcgaccgacgcgatcgaccgcctgcacaccaccgccgagtcc
caccagcgggtgatgctcgtcgaggtgatgggcaggcacgccggctggatcgccctgcac
tccgggctcgcgaccggcgcgcacctcacactcgttcccgaagtcccgttcgacgtcggc
gaggtgtgcgcgatggtgaagaagcggttccagcgcggcgattcgcatttcatctgcgtc
gtcgcggagggcgccacacccaccccggagtcgatgagtctgcgtgaaggcggcatcgac
gagttcggccacaagcggttcaccggggtcgcgcagcagctcggcgacgagatcgtccgc
cgcatcggcaaggaggtccggacgacggtcctcgggcacgtgcagcgcggcggcacgccg
acgccgtacgaccgggtgctcgccacccgcttcggggtccacgccaccgacgccgtccac
cgcggcgacttcggcaacatggtcgcgctgcacggcacgtcgatcgacctcgtgcccctc
gaggaggccacccgccgcctcaagacggtgccgcgggagcggtacgacgaggcggccgca
tttttcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system