KEGG   Rhodococcus opacus B4: ROP_66490Help
Entry
ROP_66490         CDS       T00882                                 

Definition
magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROP_66490
Enzymes [BR:rop01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ROP_66490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7266563..7268476
Genome map
AA seq 637 aa AA seqDB search
MDQVRPDFSWGFPFSAVVGQDRLRLALVLCAVHPGIGGVLVRGEKGTAKSTVVRALTALL
PAVQDENGTRPARLIELPVGATEDRVVGSLDLEKVLRDGERAFQPGLLSAAHQGVLYVDE
VNLLHDHLVDVLLDAAAMGRVHVERDGISHSHAARFVMVGTMNPEEGELRPQLLDRFGLA
VDVAASREVDVRMEVVRRRLDFERDPAGFVERYAEQDAALAAAILAARDRLDSVVLDDVE
LRRIASLCASFDVDGMRADLVLARTATAHAAWRGAGAVEAEDVRVAAELTLPHRRRRDPF
DEPGLDEQQLDDALRQADEDARSGGGEQPEQEPGTPPTAPPAADGADTDPEGPDDPDGPG
GGAPAPPERPAGPTGTQFTTKLLEVPGVGEGAPGRRSRSRSSRGRAVRSTAESGHGLHLV
GTLFAAAGQQVARGRTTGRMILDSVDLRGAIREGREGNLVVFVVDASGSMAARDRLSAVT
GAVVSLLRDAYQRRDKVAVITVRGRAAELVLPPTSSVDIAVRRLQGMKTGGKSPLAEGFL
RAREVVLRERLRDPQRRALVVALTDGRATGGKDALHRAKVAAGLLADSAVASVVVDCESG
MVRLGLAAELARRLRGGYVRLGELSAQQVAGVVRAAA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaggttcgacccgacttttcgtggggttttccgttcagtgcggtggtcggccag
gaccggttgcggctggccctcgtcctctgcgcggtccatcccggcatcggcggcgtcctc
gtccgcggtgagaaggggacggccaagtcgacggtggtccgtgctctcaccgcgttgctg
cccgcggtgcaggacgagaacggcacccgcccggcgcggctgatcgaattgcccgtcgga
gccacggaagaccgcgtcgtcggttccctcgatctggagaaggtgctgcgcgacggtgag
cgcgcgttccagcccggactgctgtcggccgcgcatcagggtgtgctctacgtcgacgag
gtcaatctgctgcacgaccatctggtggacgtgcttctcgacgcggcggcgatgggccgc
gtgcacgtcgaacgggacggcatctcgcattcgcacgccgcccggttcgtgatggtcggc
acgatgaatcctgaggaaggtgagctccggccgcagctcctcgaccgcttcgggctggcc
gtggacgtggccgcgtcgcgggaggtggacgtgcgcatggaggtggtgcggcgtcgtctg
gacttcgagcgcgaccccgcggggttcgtcgagcgctacgccgagcaggacgccgccctc
gccgcggccatcctcgcggcccgcgaccggctcgactccgtcgtgctcgacgacgtcgag
ttgcgccgaatcgcttctctctgtgcgtcgttcgatgtggacggcatgcgcgccgatctc
gtcctcgcccgcacggcgaccgcgcacgccgcgtggcggggcgccggggccgtcgaggcg
gaggacgtgcgagtggccgccgaactgaccctgccgcaccgccgccgccgggatccgttc
gacgaacccggtctcgacgaacagcaactcgacgacgctctccggcaggccgacgaggat
gcgcggtccggcggcggggaacagccggagcaggaacccggaactccgcccaccgcaccg
cccgcggcggacggcgcggacaccgaccccgagggtcccgacgatccggacgggcccggc
ggcggcgcaccggcacccccggagcgcccggccgggccgaccggcacccagttcaccacc
aaactcctcgaggtacccggagtcggcgagggcgcgccgggccggcgctcacgttcccgc
tcgtcgcgcggtcgcgcggtgcgctcgaccgccgagtctgggcacggactccacctcgtg
ggcacgctcttcgccgcagccgggcagcaggtggcccgcggccggaccaccgggcggatg
atcctcgattccgtcgatctgcgcggagcgatccgcgaaggccgcgagggcaacctcgtg
gtgttcgtcgtggacgcatccgggtcgatggcggcccgtgaccggttgtcggccgtgacc
ggcgccgtcgtctcactgctccgcgacgcgtaccagcgccgcgacaaggtggcggtgatc
acggtccgcggacgggccgcggaactcgtcctgccgcccacctcgtcggtcgacatcgcc
gtccgccgtctgcagggaatgaagacgggcggcaagtctccactggcagaaggatttctg
cgcgcgcgcgaggtcgtgttgcgggaacggctccgcgacccgcagcgccgcgccctcgtc
gtcgcgctgaccgacgggcgggcgaccggcggtaaggatgcgttgcaccgtgcgaaggtg
gccgcggggctgctcgccgacagcgcggtcgcgtccgtggtcgtcgactgcgagagcggg
atggtccggctcgggctggccgcggagctggcccgccggttgcggggtgggtacgtccgg
ctcggcgaattgtccgcgcagcaggtcgcgggcgtcgtccgcgccgcggcctga

DBGET integrated database retrieval system