KEGG   Rhodococcus opacus B4: ROP_67230Help
Entry
ROP_67230         CDS       T00882                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROP_67230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_67230
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_67230
  Amino acid metabolism
   00350 Tyrosine metabolism
    ROP_67230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROP_67230
   00626 Naphthalene degradation
    ROP_67230
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROP_67230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7340194..7341300
Genome map
AA seq 368 aa AA seqDB search
MKIRGAVLEEIGRARPFAESAPISISELDLDEPGAGEILVRIEAAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGRITQLGAGVDDVAVGQRVVMTFLPRCGECEGCATDGRMPCVPGTSAN
NDGTLLDGGARLHRGDDRVHHHLGVSGFATHAVVNRRSVVPVGDDVPADVAAVLGCAVLT
GGGAVLNAGDPRPGQAVMVVGLGGVGMAAILTAVSRGAGEVIGVDAVPAKLQTARELGAT
AVYTPAELEEAGIRAPIVIEAAGNARAFESAVRATAPGGKTITVGLPSPNAQSSISPLTL
VAEARTIIGSYLGSAVPSRDIPIYEALWRSGKLPVEKLISSRITLDDINRGMDELADGKA
IRQIIVFD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgtggagcggtactcgaggagatcggcagagcgcgcccgttcgccgagtcg
gcgccgatctcgatttccgaactcgacctcgacgaacccggggcgggcgagattctcgtc
cggatcgaggccgcgggtctgtgccactccgatctgtccgtcgtcgacggcaaccgggtg
cgcccggtcccgatgctcctcggacacgaagcggccggacggatcacgcaactcggggcg
ggtgtcgacgacgttgcggtcgggcagcgcgtggtgatgacgttcctcccgcgctgcggg
gaatgtgagggctgcgccacggacggccgcatgccgtgcgtgcccggcaccagcgccaac
aacgacggaaccctgctcgacgggggagcgcgactgcaccgcggcgacgaccgcgtgcac
caccacctcggggtgtccggattcgcgacgcacgcggtcgtcaaccggcgctcggtcgtt
ccggtcggcgacgacgttcccgccgacgtggcggccgtgctcggatgcgccgtcctcacc
ggcggcggcgcggtcctcaacgccggcgatccgcgtcccggccaggccgtgatggtcgtc
gggctcggcggcgtgggaatggccgcgatcctgacggccgtgtcccggggcgccggtgag
gtcatcggtgtcgacgccgtgcccgcgaaactgcagactgcccgcgaactcggagcgacg
gcggtctacacccccgcggaactcgaggaagccggcatccgggcgcccatcgtcatcgag
gccgcggggaacgcccgcgctttcgaatcagccgttcgcgcaaccgctcccggcggcaag
acgatcaccgtaggactgccgtccccgaacgcgcagtcgtcgatctccccgctcaccctg
gtggccgaggcccgcacgatcatcggcagctacctcggctcggcggtgccgtcccgggac
atccccatctacgaagccctgtggcgctccgggaagctgcccgtggagaaactcatctcc
tcccgcatcacgctcgacgacatcaaccgcggcatggacgaactcgccgacggcaaggcg
atccgtcagatcatcgtgttcgactga

DBGET integrated database retrieval system