KEGG   Rhodococcus opacus: ROP_67680Help
Entry
ROP_67680         CDS       T00882                                 

Definition
fructose-specific phosphotransferase system enzyme II (EC:2.7.1.69)
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
rop  Rhodococcus opacus
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rop00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:rop02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7381164..7383269)
Genome map
AA seq 701 aa AA seqDB search
MSHSTPDRDSGPQIISEDLISLDTDLGATKEDVITALSQRLADAGRATEADALRDAALAR
ESQSATGLPGGIAIPHCRSEAVVAASLGFARLAPKVDFGAPDGPADLVFLIAAPEGAGAE
HMKLLSSLARALVRPAFVGALRDAKTPGEIVTLVNDVLAPAPAPAAAPAAATAAAAAAPA
ATAAAAPAAKPEPVTVEKEPEPEAGPKHIVAVTACPTGIAHTYMAADSLVAAGERAGVVV
HVETQGSSGSTPLAAGVIAGASAVIFATDVGVKGKERFAGKPVVASGVKRAINEPDTMIT
EALRAGMNPSAATVDAGSSGGATDEPAGSVGWGTHLRQVLLTGVSYMIPFVAAGGLLIAL
GFLLGGYEISGPAEDIVLNNSLGQLPDGGLTTYLGAVLFQLGSLAFSFLVPALAGYIAFA
IADRPGLAPGFTAGAVAVFVGGGFIGGLVGGLIAGVVALWISRIPVPQWLRGLMPVVIIP
LFATLIVGALMFLVLGRPLAAITTGLTDWLNGLSGSSVIFLGIILGLMMCFDLGGPVNKA
AYAFAVAGLNVNDPASLRIMAAVMAAGMVPPLAMALASTVLRPSLFSEAERENGKAAWLL
GSAFISEGAIPFAAADPLRVIPSMMAGGAVTGALIMAFDVTLSAPHGGIFVFFAIGNLLW
FLVALAAGVVVAALCVVGAKEFIKPGASDAELDPDVATVAA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctcactcgacacccgaccgcgattcggggccgcagatcatcagcgaagatctgatc
tccctggacaccgacctcggagccaccaaggaggacgtgatcaccgcgctctcccagcgc
ctggcggacgccggtcgcgccaccgaagcggacgctctccgcgacgccgccctggcgcgt
gaatcccaatcggcgacaggacttcccggcgggatcgccatcccgcactgccgctcggag
gccgtcgtggcggcatctctcggattcgcccggctcgccccgaaggtcgacttcggcgcc
cccgacggacccgccgatctggtgttcctcatcgccgcacccgagggtgccggtgcggag
cacatgaagctgctctcgtcgctcgcccgggcgctggtgcggccggccttcgtcggcgcg
ctgcgtgacgcgaagacccccggcgagatcgtcaccctggtgaacgacgtcctggcaccc
gcacccgcacccgccgccgcacctgctgccgcgacggcggctgctgctgctgcacccgcg
gcgactgcggcggcggctccggcagcgaaacccgaaccggtcaccgtcgagaaggaaccc
gagcccgaagcggggccgaagcacatcgtcgcggtcacggcctgcccgaccggcatcgcc
cacacctacatggccgcggactccctcgtcgccgccggcgaacgcgccggcgtcgtcgtc
cacgtggagacgcagggatcgagtggcagcacaccgctcgcggccggcgtgatcgcgggc
gcatccgccgtcatcttcgccaccgacgtcggggtgaagggcaaggagcgtttcgcaggc
aagccggtggtggcatcaggcgtcaaacgcgcgatcaacgagcccgacaccatgatcacc
gaggcgctgcgtgcgggcatgaacccgtccgccgcgaccgtggacgcgggtagctcaggc
ggcgccacggacgaacccgccggatcggtcggctggggcacccacctgcgtcaggtgctg
ctcaccggcgtcagctacatgatcccgttcgttgccgcgggtggtctgctgatcgccctc
ggattcctgctcggcgggtacgagatctccggtcccgcggaggacatcgtcctcaacaac
tctctcggccaactccccgacggcggcctgacgacgtacctgggcgcggtgctgttccag
ctgggttcgctggcgttcagcttcctcgtccctgcgctggccggttacatcgccttcgcg
atcgccgaccggcccggcctggcgccgggcttcaccgccggtgcggtggcggtcttcgtc
ggcggcggattcatcggaggcctcgtcggcggtctgatcgccggtgtggtcgcgctgtgg
atcagccggatcccggtgccccagtggttgcgcggcctgatgcccgtggtgatcatcccg
ctgttcgcgacgctgatcgtcggcgccctcatgttcctggtcctcggccgtccactcgcc
gcgatcacgacgggcctgacggactggctcaacggattgtccggcagttccgtcatcttc
ctcggcatcatcctcggcctgatgatgtgcttcgacctcggaggcccggtcaacaaggcg
gcatacgcgttcgcggtggccggcctcaacgtcaacgaccctgcctcgctgcggatcatg
gcggccgtgatggctgcgggcatggtcccgccgctggccatggcgctggcgtcgacggtc
ctgcggcccagcctgttcagcgaggcggaacgggagaacggcaaggcggcgtggctgctc
ggctcggcgttcatctccgaaggcgccatcccgttcgcggccgccgacccgctgcgcgtc
atcccctcgatgatggccggcggcgccgtcaccggcgccctgatcatggcgttcgacgtc
accctcagcgcaccgcacggcggaatcttcgtcttcttcgccatcggcaacctgctgtgg
ttcctggtagcgctcgccgccggtgtcgtcgtcgccgcactctgcgtcgtcggcgccaag
gaattcatcaagcccggcgcgtccgacgccgaactcgaccccgacgttgcgacagtcgca
gcgtaa

DBGET integrated database retrieval system