KEGG   Rhodococcus opacus B4: ROP_67680Help
Entry
ROP_67680         CDS       T00882                                 

Definition
fructose-specific phosphotransferase system enzyme II (EC:2.7.1.69)
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
rop  Rhodococcus opacus B4
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ROP_67680
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    ROP_67680
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     ROP_67680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7381164..7383269)
Genome map
AA seq 701 aa AA seqDB search
MSHSTPDRDSGPQIISEDLISLDTDLGATKEDVITALSQRLADAGRATEADALRDAALAR
ESQSATGLPGGIAIPHCRSEAVVAASLGFARLAPKVDFGAPDGPADLVFLIAAPEGAGAE
HMKLLSSLARALVRPAFVGALRDAKTPGEIVTLVNDVLAPAPAPAAAPAAATAAAAAAPA
ATAAAAPAAKPEPVTVEKEPEPEAGPKHIVAVTACPTGIAHTYMAADSLVAAGERAGVVV
HVETQGSSGSTPLAAGVIAGASAVIFATDVGVKGKERFAGKPVVASGVKRAINEPDTMIT
EALRAGMNPSAATVDAGSSGGATDEPAGSVGWGTHLRQVLLTGVSYMIPFVAAGGLLIAL
GFLLGGYEISGPAEDIVLNNSLGQLPDGGLTTYLGAVLFQLGSLAFSFLVPALAGYIAFA
IADRPGLAPGFTAGAVAVFVGGGFIGGLVGGLIAGVVALWISRIPVPQWLRGLMPVVIIP
LFATLIVGALMFLVLGRPLAAITTGLTDWLNGLSGSSVIFLGIILGLMMCFDLGGPVNKA
AYAFAVAGLNVNDPASLRIMAAVMAAGMVPPLAMALASTVLRPSLFSEAERENGKAAWLL
GSAFISEGAIPFAAADPLRVIPSMMAGGAVTGALIMAFDVTLSAPHGGIFVFFAIGNLLW
FLVALAAGVVVAALCVVGAKEFIKPGASDAELDPDVATVAA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctcactcgacacccgaccgcgattcggggccgcagatcatcagcgaagatctgatc
tccctggacaccgacctcggagccaccaaggaggacgtgatcaccgcgctctcccagcgc
ctggcggacgccggtcgcgccaccgaagcggacgctctccgcgacgccgccctggcgcgt
gaatcccaatcggcgacaggacttcccggcgggatcgccatcccgcactgccgctcggag
gccgtcgtggcggcatctctcggattcgcccggctcgccccgaaggtcgacttcggcgcc
cccgacggacccgccgatctggtgttcctcatcgccgcacccgagggtgccggtgcggag
cacatgaagctgctctcgtcgctcgcccgggcgctggtgcggccggccttcgtcggcgcg
ctgcgtgacgcgaagacccccggcgagatcgtcaccctggtgaacgacgtcctggcaccc
gcacccgcacccgccgccgcacctgctgccgcgacggcggctgctgctgctgcacccgcg
gcgactgcggcggcggctccggcagcgaaacccgaaccggtcaccgtcgagaaggaaccc
gagcccgaagcggggccgaagcacatcgtcgcggtcacggcctgcccgaccggcatcgcc
cacacctacatggccgcggactccctcgtcgccgccggcgaacgcgccggcgtcgtcgtc
cacgtggagacgcagggatcgagtggcagcacaccgctcgcggccggcgtgatcgcgggc
gcatccgccgtcatcttcgccaccgacgtcggggtgaagggcaaggagcgtttcgcaggc
aagccggtggtggcatcaggcgtcaaacgcgcgatcaacgagcccgacaccatgatcacc
gaggcgctgcgtgcgggcatgaacccgtccgccgcgaccgtggacgcgggtagctcaggc
ggcgccacggacgaacccgccggatcggtcggctggggcacccacctgcgtcaggtgctg
ctcaccggcgtcagctacatgatcccgttcgttgccgcgggtggtctgctgatcgccctc
ggattcctgctcggcgggtacgagatctccggtcccgcggaggacatcgtcctcaacaac
tctctcggccaactccccgacggcggcctgacgacgtacctgggcgcggtgctgttccag
ctgggttcgctggcgttcagcttcctcgtccctgcgctggccggttacatcgccttcgcg
atcgccgaccggcccggcctggcgccgggcttcaccgccggtgcggtggcggtcttcgtc
ggcggcggattcatcggaggcctcgtcggcggtctgatcgccggtgtggtcgcgctgtgg
atcagccggatcccggtgccccagtggttgcgcggcctgatgcccgtggtgatcatcccg
ctgttcgcgacgctgatcgtcggcgccctcatgttcctggtcctcggccgtccactcgcc
gcgatcacgacgggcctgacggactggctcaacggattgtccggcagttccgtcatcttc
ctcggcatcatcctcggcctgatgatgtgcttcgacctcggaggcccggtcaacaaggcg
gcatacgcgttcgcggtggccggcctcaacgtcaacgaccctgcctcgctgcggatcatg
gcggccgtgatggctgcgggcatggtcccgccgctggccatggcgctggcgtcgacggtc
ctgcggcccagcctgttcagcgaggcggaacgggagaacggcaaggcggcgtggctgctc
ggctcggcgttcatctccgaaggcgccatcccgttcgcggccgccgacccgctgcgcgtc
atcccctcgatgatggccggcggcgccgtcaccggcgccctgatcatggcgttcgacgtc
accctcagcgcaccgcacggcggaatcttcgtcttcttcgccatcggcaacctgctgtgg
ttcctggtagcgctcgccgccggtgtcgtcgtcgccgcactctgcgtcgtcggcgccaag
gaattcatcaagcccggcgcgtccgacgccgaactcgaccccgacgttgcgacagtcgca
gcgtaa

DBGET integrated database retrieval system