KEGG   Rhodococcus opacus B4: ROP_69600Help
Entry
ROP_69600         CDS       T00882                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00010  Glycolysis / Gluconeogenesis
rop00051  Fructose and mannose metabolism
rop00562  Inositol phosphate metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
rop01230  Biosynthesis of amino acids
Module
rop_M00002  Glycolysis, core module involving three-carbon compounds
rop_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_69600 (tpiA)
   00051 Fructose and mannose metabolism
    ROP_69600 (tpiA)
   00562 Inositol phosphate metabolism
    ROP_69600 (tpiA)
Enzymes [BR:rop01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROP_69600 (tpiA)
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROP_69600 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROP_69600 (tpiA)
  Exosomal proteins of melanoma cells
   ROP_69600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAH55207
NITE: ROP_69600
UniProt: C1B4L8
Position
7590124..7590909
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLVEGD
KLLLTYGAQDVSAQDSGAYTGEISGSMLAKLGCTFVVVGHSERRTLHGEDNETVLAKTKA
SLKNGLTPIVCIGEGLEIREAGEHVSYNVEQLRGSLAGLSAEDITRVVIAYEPVWAIGTG
KVASAADAQEVCAAIRATLGELASPDVASGVRVLYGGSVNAKNVGEIVGQTDVDGALVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaagccgctgatcgccggcaactggaagatgaatctgaaccacctcgaggcc
atcgcgctggttcagaagatcgccttctcgctcccggcgaagtacttcgacaaggtcgac
gtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgagggcgac
aagctcctgctcacctacggtgcgcaggacgtgtcggcccaggattcgggcgcgtacacc
ggcgagatcagcggctccatgctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcgccggaccctgcacggtgaggacaacgagaccgtgctggccaagaccaaggcc
tcgctgaagaacgggctcacccccatcgtgtgcatcggggagggcctcgagattcgcgag
gccggcgagcacgtgtcctacaacgtcgagcagctgcggggttcgctcgccgggctgtcc
gccgaggacatcaccagggtcgtcatcgcgtacgagccggtgtgggccatcggcaccggc
aaggtcgccagtgccgcggacgcgcaggaagtgtgcgctgcgatccgtgccacgctcggc
gagctggcctcgccggacgtcgcgtccggtgtccgcgttctgtacggcggcagcgtcaac
gcgaagaacgtcggcgagatcgtcggtcagacggatgtggacggcgccctcgtgggcggc
gcctcgctgaaggccgacgagttcgccacgctgtcggcgatcgccgcgggcgggcccctg
ccgtaa

DBGET integrated database retrieval system