KEGG   Rhodococcus opacus B4: ROP_69600Help
Entry
ROP_69600         CDS       T00882                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_69600 (tpiA)
   01230 Biosynthesis of amino acids
    ROP_69600 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_69600 (tpiA)
   00051 Fructose and mannose metabolism
    ROP_69600 (tpiA)
   00562 Inositol phosphate metabolism
    ROP_69600 (tpiA)
Enzymes [BR:rop01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROP_69600 (tpiA)
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROP_69600 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROP_69600 (tpiA)
  Exosomal proteins of melanoma cells
   ROP_69600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7590124..7590909
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLVEGD
KLLLTYGAQDVSAQDSGAYTGEISGSMLAKLGCTFVVVGHSERRTLHGEDNETVLAKTKA
SLKNGLTPIVCIGEGLEIREAGEHVSYNVEQLRGSLAGLSAEDITRVVIAYEPVWAIGTG
KVASAADAQEVCAAIRATLGELASPDVASGVRVLYGGSVNAKNVGEIVGQTDVDGALVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaagccgctgatcgccggcaactggaagatgaatctgaaccacctcgaggcc
atcgcgctggttcagaagatcgccttctcgctcccggcgaagtacttcgacaaggtcgac
gtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgagggcgac
aagctcctgctcacctacggtgcgcaggacgtgtcggcccaggattcgggcgcgtacacc
ggcgagatcagcggctccatgctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcgccggaccctgcacggtgaggacaacgagaccgtgctggccaagaccaaggcc
tcgctgaagaacgggctcacccccatcgtgtgcatcggggagggcctcgagattcgcgag
gccggcgagcacgtgtcctacaacgtcgagcagctgcggggttcgctcgccgggctgtcc
gccgaggacatcaccagggtcgtcatcgcgtacgagccggtgtgggccatcggcaccggc
aaggtcgccagtgccgcggacgcgcaggaagtgtgcgctgcgatccgtgccacgctcggc
gagctggcctcgccggacgtcgcgtccggtgtccgcgttctgtacggcggcagcgtcaac
gcgaagaacgtcggcgagatcgtcggtcagacggatgtggacggcgccctcgtgggcggc
gcctcgctgaaggccgacgagttcgccacgctgtcggcgatcgccgcgggcgggcccctg
ccgtaa

DBGET integrated database retrieval system