KEGG   Rhodococcus opacus B4: ROP_pROB01-02440Help
Entry
ROP_pROB01-02440  CDS       T00882                                 

Definition
putative phosphodiesterase/alkaline phosphatase (EC:3.1.3.1 3.1.4.-)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ROP_pROB01-02440
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ROP_pROB01-02440
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ROP_pROB01-02440
Enzymes [BR:rop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ROP_pROB01-02440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pROB01:230052..231629
Genome map
AA seq 525 aa AA seqDB search
MPLSRRQLLRVGVAGSAAVLVGTSAVSSARLPAPRWRGDDPFGLGVASGDPTPDGVVLWT
RLAPDPLAPGGRGGMGWDPVTVEYEVAHDESFRQVVTRGTAVATRELAHSVHPEIHGLEP
ARWYFYRFRAGSAISAVGRTRTAPAPGQPTARMRLAFASCQSWSSGFYTAYEHMRDEDLD
LVIHLGDYIYERGWRRGREGMPMGADRDEAVDLPSYRLHYAQYKAEKPLRDAHAAFPWIV
TMDDHEVDNNWAADSPGLGFDIYRIPALFRRRRAAAFQAMYEHQPLRLTQLPSGESMRLH
RRYWFGDLAQITMLDTRQYRDRQACGGNVTADCADRLDTDRTILGAQQRDWLLDGFTGSP
ARWQIIGNQVAMGQTDNDPGPDTVVSADSWDGYVADRNTVLGGAADRGVRNLVVITGDRH
QNIVADLRRDYADPESPVIASEFSGTSITSAGDGADMNDTGRRLLAANPDMKFFNAQRGY
VRVDLDHQLWRNDFRVVPYIQRPGAPIHTRASFVVQDQRPSVTEA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtcccgtcggcagttgttgcgggtaggtgtggccggatcggctgcggtgctg
gtgggtacgtcggcggtgagtagcgcccggttgccggcgccgcggtggcgaggagatgac
ccgttcggactcggtgtggcatcgggagatccgacacccgatggtgtcgtcctgtggacc
cgcctggcaccggatccgcttgcccccggcgggcgcggcggcatggggtgggatccggtg
accgtcgaatacgaagtcgcgcatgacgagagcttccggcaggtggtgacgcgcggtacg
gcggtcgcgacgcgcgaactcgcccacagcgtgcacccggagatccacggtttggagccc
gctcgctggtacttctaccgatttcgtgccggttcggcgatctctgcggtgggccggacc
cgcacggccccggctccggggcagcccaccgcgcggatgcggctcgcgttcgcctcctgt
caatcgtggagttcgggcttctacaccgcatacgagcacatgcgcgacgaagacctcgat
ctggtcatccatctgggcgactacatctacgagcgcgggtggaggcgcggccgcgaggga
atgccgatgggagcggaccgcgacgaagccgtcgatctgcccagctaccggctgcactac
gcacagtacaaagccgagaagccgctgcgcgacgcccatgcagcttttccctggatcgtg
accatggacgatcacgaggtcgacaacaactgggccgccgattcgccgggactgggcttc
gatatctaccgaatacccgcactgttccgccgtcgccgtgccgcggccttccaggcgatg
tacgagcaccagccgctgcggctcacgcaactgccctccggggagagtatgcgcctgcac
cgccgctactggttcggcgatctcgcgcagatcaccatgctcgatacccggcaataccgg
gaccggcaggcctgcgggggaaacgtcaccgcggactgcgccgaccggctcgacaccgac
cgcacgatactgggcgcccagcaacgggactggctgctcgacggattcaccggctccccg
gcccgctggcagatcatcggcaatcaggtagcgatgggccagaccgacaacgaccccggc
ccggacaccgtcgtgtccgccgactcgtgggacggatacgtcgccgaccgcaacaccgtc
ctcggcggcgcagccgatcggggcgtccgcaatctggtggtgatcaccggcgaccgtcac
cagaacatcgtcgccgacctgcgccgggactacgccgacccagaatccccggtcatcgca
tcggaattctcgggaacgtcgatcacctcagccggcgacggcgccgacatgaacgacacc
ggccgccgcctgctggccgccaatcccgacatgaagttcttcaacgcgcagcgtggatac
gtgcgggtcgacctggaccatcaattgtggcgcaacgacttccgcgtcgttccctatatc
cagcgcccgggcgcgcccatccacacccgcgccagcttcgtggtccaggatcagagaccc
agcgtcaccgaggcgtga

DBGET integrated database retrieval system