KEGG   Rhodococcus opacus B4: ROP_pROB01-05410Help
Entry
ROP_pROB01-05410  CDS       T00882                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rop  Rhodococcus opacus B4
Brite
Enzymes [BR:rop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ROP_pROB01-05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pROB01:complement(506841..508103)
Genome map
AA seq 420 aa AA seqDB search
MTIHHRNPYRTAPAVRLRGIIGGDGRRRIDLTENGTAEVRASFVRDVLGSLPGLDARIVE
AFRSVDRAAYLDRFRMPGKPDWIDASQPLSAGAAAAIYRDQALATLTAENGMPSSSSTTP
SLMLLMLHALSVAPGDRVLEIGTATGYNAALLAHLVTDAGSVVTIDSKPEIAARAAAALE
TGGITNVQVRAGDGGAAEEILRGVFDRLIATVGCATVPSQWWDCLTEDGVAVVPLRHGEA
HPLCRLRKGTEPGHWYGAFTAAANFMLADGDTLHRPRGAEHRVQLTEEQHLLDTGLGCHP
SQGWAVDFFLALQAPHLKRITVKTAGPTPQIHAGCGIADQHGNIVLVSWGRLMATTGPDS
PAVRELAGHLTAWKNLGCPSIGHYDIEILPHNATDIPTPLAGRRWTQPDRHATRIVTLRT
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatccaccatcggaacccgtacagaacagcgcctgcggtgcgactgcgcggcatc
attggcggggacggtcgaaggaggattgacttgacggagaacggcacagcggaagttcgc
gcctcgtttgtgcgcgatgtcctcggttccctcccgggactcgatgcacgaattgtcgaa
gcgttcaggtccgtggaccgagcggcgtatctcgatcgctttcgaatgccgggaaagccg
gactggatcgatgcctcccaacccctttcagccggggcggccgccgccatctacagagac
caggcactagccaccctgaccgccgagaacgggatgccgtcgagctcgtcgacgacgccc
tccctgatgctgctgatgctccacgccctgtccgttgcacccggcgatcgtgtcctcgag
atcggcacggcgacgggatacaacgccgccctgctcgcgcacctggtcaccgacgccgga
agcgtcgtgactatcgactcgaaacccgagatagccgcgcgggccgcagccgcgctcgag
accggcggcatcaccaacgtgcaggtccgtgcgggcgacggcggtgccgccgaggaaata
ctgcgcggggtcttcgaccggttgatcgcgaccgtggggtgtgcgaccgtgccgtcgcag
tggtgggactgcctcacggaggacggtgtcgctgttgtgccgctgcgtcacggcgaagcg
catcccctgtgtcgactccggaaaggaaccgagccgggccactggtatggggctttcacc
gccgcggcgaacttcatgctcgccgacggggacactcttcatcggccacgtggcgccgag
caccgcgtgcagttgaccgaggagcaacacctgctcgacaccggtctcgggtgtcacccc
agccaggggtgggccgtcgacttcttcctcgcactccaagcgccgcacctcaagcgcatt
acggtcaaaaccgccgggcccaccccgcagatccatgccggttgtggcatcgcggaccag
cacggcaacatcgtcctcgtctcctggggacgcctcatggccaccaccggacccgatagt
cccgcggtgcgtgaactcgccggccacctcaccgcatggaagaacctgggatgcccttca
atcggtcactacgacatcgagatcctgccccacaatgccaccgacattccgacgccactg
gccgggcgtcgatggacacaacccgatcgtcacgccacgcggatcgtcacactccgcacg
taa

DBGET integrated database retrieval system