KEGG   Rhodococcus opacus B4: ROP_pROB02-02250Help
Entry
ROP_pROB02-02250  CDS       T00882                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rop  Rhodococcus opacus B4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROP_pROB02-02250
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_pROB02-02250
   00650 Butanoate metabolism
    ROP_pROB02-02250
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ROP_pROB02-02250
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_pROB02-02250
   00622 Xylene degradation
    ROP_pROB02-02250
   00621 Dioxin degradation
    ROP_pROB02-02250
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ROP_pROB02-02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pROB02:complement(226153..227136)
Genome map
AA seq 327 aa AA seqDB search
MSENTRKVTVAVIGSGNIGTDLMIKVIRHSDVLQMGAMVGIDPDSDGLARARRLGVPTTA
VGVHGLLELPNFDEIDVVFDATSAKAHAANAALLEPLGKRLIDLTPAALGPFVVPAVNLD
EHRHAANVNMVTCGGQATIPIVAAVSRVTPVAYAEIVASIASKSAGPGTRANIDEFTETT
SHAIETVGGARRGKAIIVLNPADPPLIMRDTVLCLISARDPATHDAIRNSIQAMVEHVAT
YVPGYRLKQQVQITPVPDGQPVHTLLASGDTAAPTHQVSVFLEVEGAAHYLPAYAGNLDI
MTSAAVRYAESVADTIAAPAATQGATR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacacccgtaaggtcaccgtcgcggtgatcggatccggcaacatcggcacc
gacctgatgatcaaggtgatccgccactccgacgtcctgcagatgggcgcgatggtgggc
atcgaccccgactccgacggcctcgcccgcgcccgccgcctcggcgtccccaccaccgcc
gtcggcgtccacggcctgctggagctgccgaacttcgacgagatcgacgtggtcttcgac
gccacctccgccaaggcacacgccgccaacgccgccctgctcgaaccgctcggcaaacgg
ctgatcgacctcaccccggccgccctcggcccgttcgtggtgccggcggtcaacctcgac
gaacaccgtcacgccgccaacgtcaacatggtcacctgcggcggtcaggccaccatcccg
atcgtcgccgccgtctcccgcgtgacaccggtcgcctacgccgagatcgttgcctccatc
gcctcgaagtccgcgggaccgggcacccgggcgaacatcgacgagttcaccgaaaccacc
tcccacgccatcgaaaccgtcggcggcgcccgccgcggcaaggccatcatcgtcctcaac
ccggccgacccgccgctgatcatgcgggacacggtcctgtgcctgatctccgcccgcgac
ccggccacccacgacgccatccggaactcgatccaggcgatggtcgagcacgtcgcgacc
tacgtgcccggctaccggctcaagcagcaggtccagatcaccccggtcccggacggccaa
cccgtgcacaccctgctcgcgtccggggacacggcggcacccacccaccaggtgtcggtg
ttcctcgaagtcgaaggcgccgcacactacctgccggcctacgccggcaacctcgacatc
atgacctcggccgcggtccgctacgccgagtccgtcgccgacacgatcgccgccccggcg
gcaacccagggagccacccgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system