KEGG   Raoultella ornithinolytica B6: RORB6_02575Help
Entry
RORB6_02575       CDS       T02625                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ror  Raoultella ornithinolytica B6
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RORB6_02575
Enzymes [BR:ror01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RORB6_02575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612081..612944
Genome map
AA seq 287 aa AA seqDB search
MGKIVVAGSLHYDIMLDAHHRPEKGETVMGTGCAYKFGGKGGNQAISAARAGGDVIFIGA
VGADAQGAFLLQTLRDAGVNIESVAKIDEIPSGMSVAISDVDGDYGAVVVSNANQHIPAK
LFQRGDIWQDAGMLVLQNEVPETINLCAAIEASKRGIPVCINAAPARELSPQLESCITLL
VVNAIEARDMSGVTVNDLSSALEAAESLAKRFSQVVVTAGEHGVAFCEAGIAGSTLAARR
ITLVSTHGAGDCFMGVLCTSLMHGEALRDAVFRANEAAARHVSQPRA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattgttgtggcgggcagcctccattacgacatcatgctggatgcgcatcat
cgcccggaaaaaggtgaaacggtaatgggcacgggctgtgcttacaagtttggcggtaaa
gggggcaatcaagccatatccgctgctcgtgcgggaggggacgtcatttttattggtgcg
gtaggggctgatgcgcaaggggcgtttcttctgcagacgcttcgtgatgccggagtcaat
atcgagtcagtcgccaaaatagatgagataccttccgggatgagcgtggcgatttctgat
gtcgatggtgattatggtgcggttgtcgtctcaaatgcgaatcagcatattccggcaaaa
ctctttcaacggggtgacatctggcaagatgccggaatgctggttctacaaaatgaagtt
ccggaaacgataaatctatgtgcggccatcgaagccagcaagcgggggattccggtctgt
atcaatgcggcgccggccagagaactgagtccgcagctggaaagctgcatcactttgctg
gtggttaatgccatagaggcgcgtgatatgagtggcgtgacggtgaacgacctttcttca
gctctggaggccgctgaatcattggctaaacgtttctctcaggttgttgtcactgccggc
gaacatggtgtcgcgttttgtgaagcgggcattgcaggctcgacgttagccgccaggcgg
ataacgctggtgagtactcatggcgctggtgattgttttatgggggttttatgcaccagc
ctgatgcatggagaggcgcttcgcgatgcggtatttcgtgcgaatgaagctgccgcccgc
catgtctctcaaccccgggcataa

DBGET integrated database retrieval system