KEGG   Raoultella ornithinolytica: RORB6_03950Help
Entry
RORB6_03950       CDS       T02625                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ror  Raoultella ornithinolytica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RORB6_03950
Enzymes [BR:ror01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RORB6_03950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912654..913271
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRALVYTAEIDDRFGSGKVSSRIGLSSPAR
LFNPQTSLFSDIAAEHAQQPVHCVLVDESQFLTREQVHELSEVVDRLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSEGSLTRVQSKHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttctactattctgcaatgaatgcaggtaagtcgaccgctttgtta
cagtcgtcatacaattaccaagagcgaggcatgcgtgccctggtttataccgccgagatt
gatgaccgctttggttcaggtaaggtcagttcaagaattggtctctcctcgccagcccgc
ctgtttaaccctcagacctcgctctttagcgatattgcggccgagcatgcgcaacagcct
gttcattgtgtcctggtggatgagagtcagtttctgacccgcgagcaggtacatgaattg
tctgaagtcgtcgatcggctggatattccggtgttgtgttacggcctgcgtacggatttc
cgtggcgagttgtttattggcagtcagtatttattagcgtggtccgataagctggttgaa
ttaaaaacgatctgcttctgcggacgtaaagcgagcatggtgctgcgtctcgatcaggaa
ggtcggccatataatgaaggcgagcaggtcgtgattggcgggaatgagcgctatgtttcc
gtctgccgtaaacattataaagaggcgttaagtgaaggctcgctgacccgggtgcagagt
aaacatcgcccctgctaa

DBGET integrated database retrieval system