KEGG   Raoultella ornithinolytica: RORB6_03950Help
Entry
RORB6_03950       CDS       T02625                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ror  Raoultella ornithinolytica
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ror00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912654..913271
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRALVYTAEIDDRFGSGKVSSRIGLSSPAR
LFNPQTSLFSDIAAEHAQQPVHCVLVDESQFLTREQVHELSEVVDRLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSEGSLTRVQSKHRPC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttctactattctgcaatgaatgcaggtaagtcgaccgctttgtta
cagtcgtcatacaattaccaagagcgaggcatgcgtgccctggtttataccgccgagatt
gatgaccgctttggttcaggtaaggtcagttcaagaattggtctctcctcgccagcccgc
ctgtttaaccctcagacctcgctctttagcgatattgcggccgagcatgcgcaacagcct
gttcattgtgtcctggtggatgagagtcagtttctgacccgcgagcaggtacatgaattg
tctgaagtcgtcgatcggctggatattccggtgttgtgttacggcctgcgtacggatttc
cgtggcgagttgtttattggcagtcagtatttattagcgtggtccgataagctggttgaa
ttaaaaacgatctgcttctgcggacgtaaagcgagcatggtgctgcgtctcgatcaggaa
ggtcggccatataatgaaggcgagcaggtcgtgattggcgggaatgagcgctatgtttcc
gtctgccgtaaacattataaagaggcgttaagtgaaggctcgctgacccgggtgcagagt
aaacatcgcccctgctaa

DBGET integrated database retrieval system