KEGG   Raoultella ornithinolytica B6: RORB6_03955Help
Entry
RORB6_03955       CDS       T02625                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00010  Glycolysis / Gluconeogenesis
ror00071  Fatty acid degradation
ror00350  Tyrosine metabolism
ror00620  Pyruvate metabolism
ror00625  Chloroalkane and chloroalkene degradation
ror00626  Naphthalene degradation
ror00650  Butanoate metabolism
ror01100  Metabolic pathways
ror01110  Biosynthesis of secondary metabolites
ror01120  Microbial metabolism in diverse environments
ror01130  Biosynthesis of antibiotics
ror01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RORB6_03955
   00620 Pyruvate metabolism
    RORB6_03955
   00650 Butanoate metabolism
    RORB6_03955
  Lipid metabolism
   00071 Fatty acid degradation
    RORB6_03955
  Amino acid metabolism
   00350 Tyrosine metabolism
    RORB6_03955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RORB6_03955
   00626 Naphthalene degradation
    RORB6_03955
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RORB6_03955
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RORB6_03955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AGJ85484
Position
complement(913627..916305)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADVKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFTVPATTKILIGEVTDVDESEPFAHEKLSPTLAMYRAKNFEDAVDKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKASGVETEVFFEVEADPTLSVVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDVAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTFYGNEFSEGETAAKKETAAAPKADKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgcgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagttgataagatcttccgtgccgccgctttg
gccgccgcagatgctcgaatccctctcgcaaaaatggccgtagccgaatctggcatgggc
attgtcgaagacaaggttatcaaaaaccacttcgcttccgaatatatctataacgcatat
aaagatgaaaagacctgcggtgttctctctgaagacgacactttcgggactatcaccatc
gccgaacctatcggtattatctgcggtatcgttccgacgactaacccgacttccacagca
atcttcaaatcactgatcagcctgaagacgcgtaacgcgatcatcttctctccacatccg
cgtgcgaaagatgcgaccaacaaagcggcagatatcgtgctgcaggccgctatcgctgca
ggcgcaccgaaagatctgatcggttggatcgaccagccttccgttgagctgtctaacgcg
ctgatgcatcaccctgacattaacctgatcctcgcgaccggcggtccaggcatggttaaa
gcagcctatagctccggtaaaccggctatcggcgtgggtgcaggtaacactccggttgtt
attgatgaaactgcagacgttaagcgcgcggtcgcttccgtactgatgtctaaaaccttt
gataatggcgttatctgtgcgtctgagcagtcagtcgttgttgttgactctgtctatgac
gccgttcgcgagcgtttcgccagccacggcggctatctgctgcagggcaaagagctgaaa
gccgttcaggacatcatcctgaaaaatggcgcactgaacgcggcaatcgtaggtcagccg
gcatacaaaattgctgaactggcaggcttcaccgttccggctaccaccaagattctgatt
ggtgaagtgaccgacgttgatgaaagcgagccgtttgctcacgaaaaactgtctccgacg
ctggcgatgtaccgcgcgaagaacttcgaagatgctgttgataaagctgaaaaactggtt
gcgatgggcggtatcggtcatacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgttgcctacttcggccagatgatgaaaaccgcacgtatcctgattaacaccccggct
tctcagggtggtatcggtgacctgtacaactttaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctcactgccaatcgcactggatgaagtgattactgatggtcacaaa
cgcgcgctgattgtgactgaccgcttcctgttcaacaacggttatgcagaccagatcacc
tccgtgctgaaggcatccggcgttgagactgaagtcttcttcgaagttgaagctgacccg
accctgagcgtagtacgtaaaggtgcggatctggctaactccttcaagccggacgttatc
atcgccctgggcggtggttccccgatggatgccgcgaaaatcatgtgggtaatgtacgaa
catccggaaactcacttcgaagacctggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaagatgatcgccgtcaccaccacttccggt
accggttctgaagttacgccattcgccgttgttaccgacgatgcaacgggtcagaaatat
ccgctggctgactacgcgctgactccggacgtcgcgattgttgatgctaacctcgtgatg
gatatgccgaagtccctgtgtgctttcggtggtcttgacgccgtgactcacgccctggaa
gcctatgtttccgtactggcatctgagttctccgacggccaggctctgcaggcgctgaaa
ctgctgaaagagtacctgccagcgtcctaccacgaaggttctaagaacccggtagcacgt
gaacgtgtgcacagtgcagcaactatcgccggtatcgcgtttgctaacgccttcctcggc
gtatgtcactccatggcgcacaaactgggttctcagttccacattccgcacggcctggct
aacgccctgctgatttgtaacgtgattcgttacaacgcgaatgacaacccgaccaagcag
actgcattcagccagtacgaccgtccgcaggcacgccgtcgctacgctgaaatcgcggac
cacctgggtctgagcgcaccgggcgaccgtaccgcagcgaaaattgaaaaactgctggca
tggctggaaagcctgaaggctgaactgggtattcctaagtctatccgtgaagccggcgta
caggaagctgacttcctggcccacgttgacaagctgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctatccgctgattgccgagctgaaacagattctgctggat
accttctacggtaacgagttcagcgaaggtgaaactgccgcgaagaaagagaccgcagca
gcgccaaaagccgataaaaaagcgaagaaatctgcttaa

DBGET integrated database retrieval system