KEGG   Raoultella ornithinolytica B6: RORB6_04295Help
Entry
RORB6_04295       CDS       T02625                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ror  Raoultella ornithinolytica B6
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RORB6_04295
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RORB6_04295
   00650 Butanoate metabolism
    RORB6_04295
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RORB6_04295
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RORB6_04295
   00622 Xylene degradation
    RORB6_04295
   00621 Dioxin degradation
    RORB6_04295
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RORB6_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985552..986502
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPESDGLARARRMGVATTHEGVG
GLMQMAEFADIDIVFDATSAGAHVKNDAALREAKPEIRMIDLTPAAIGPYCVPVVNLEAN
LAEGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASKSAGPGTRANIDEFTETTSQ
AIEKVGGAAKGKAIIVLNPAEPPLMMRDTVYLLSEAASQQEIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGIGRFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQSMNDAAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgcaaagtcgccattatcggctccggtaatatcggcaccgatttaatgatc
aaaattctgcgccatggccaacacctggagatggcggtgatggtcggtatcgaccctgaa
tccgacggtctggcccgcgcccggcgcatgggcgtcgccaccactcatgagggcgtcggc
ggcctgatgcagatggcggagtttgccgatatcgatattgtatttgacgccaccagcgcc
ggggcgcacgtgaaaaacgacgccgcgttgcgggaagccaaaccggagatccgcatgatc
gacctgacgccggcggccatcggcccgtactgcgtgccggtggtcaatcttgaggccaat
cttgccgagggtaatgtcaatatggtgacctgcggcggccaggcgaccatcccgatggtg
gcggcggtatcgcgggtggccaaagtgcactatgcggaaatcgtcgcctcgattgccagt
aaatctgccggtccgggaacacgcgctaacatcgacgaattcactgaaaccacctcgcag
gctatagagaaagtcggcggcgcggcaaaaggtaaagcgattatcgtactgaacccggcg
gagccgccgctgatgatgcgcgatactgtatatctcctgagcgaagcggcgtcgcagcag
gaaattgccgcgtcgattgcggagatggcggccgcggtgcaggcctatgtcccgggatat
cgcctgaaacagcaggtgcagtttgaggtgattcccgaagataagccggtcaacctgccg
ggcattggccgcttctccggtctgaaaacggcggtttacctcgaggttgaaggggcggcg
cactatctgcctgcctacgcgggtaacctcgatattatgacctcggctgcgctggcgacg
gcggaaaaaatggcccagtcaatgaacgacgcggcgggagaagcagcatga

DBGET integrated database retrieval system