KEGG   Raoultella ornithinolytica B6: RORB6_04295Help
Entry
RORB6_04295       CDS       T02625                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00360  Phenylalanine metabolism
ror00362  Benzoate degradation
ror00620  Pyruvate metabolism
ror00621  Dioxin degradation
ror00622  Xylene degradation
ror00650  Butanoate metabolism
ror01100  Metabolic pathways
ror01120  Microbial metabolism in diverse environments
ror01220  Degradation of aromatic compounds
Module
ror_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RORB6_04295
   00650 Butanoate metabolism
    RORB6_04295
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RORB6_04295
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RORB6_04295
   00622 Xylene degradation
    RORB6_04295
   00621 Dioxin degradation
    RORB6_04295
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RORB6_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH Goodbye NAD_binding_7 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGJ85552
Position
985552..986502
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPESDGLARARRMGVATTHEGVG
GLMQMAEFADIDIVFDATSAGAHVKNDAALREAKPEIRMIDLTPAAIGPYCVPVVNLEAN
LAEGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASKSAGPGTRANIDEFTETTSQ
AIEKVGGAAKGKAIIVLNPAEPPLMMRDTVYLLSEAASQQEIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGIGRFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQSMNDAAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgcaaagtcgccattatcggctccggtaatatcggcaccgatttaatgatc
aaaattctgcgccatggccaacacctggagatggcggtgatggtcggtatcgaccctgaa
tccgacggtctggcccgcgcccggcgcatgggcgtcgccaccactcatgagggcgtcggc
ggcctgatgcagatggcggagtttgccgatatcgatattgtatttgacgccaccagcgcc
ggggcgcacgtgaaaaacgacgccgcgttgcgggaagccaaaccggagatccgcatgatc
gacctgacgccggcggccatcggcccgtactgcgtgccggtggtcaatcttgaggccaat
cttgccgagggtaatgtcaatatggtgacctgcggcggccaggcgaccatcccgatggtg
gcggcggtatcgcgggtggccaaagtgcactatgcggaaatcgtcgcctcgattgccagt
aaatctgccggtccgggaacacgcgctaacatcgacgaattcactgaaaccacctcgcag
gctatagagaaagtcggcggcgcggcaaaaggtaaagcgattatcgtactgaacccggcg
gagccgccgctgatgatgcgcgatactgtatatctcctgagcgaagcggcgtcgcagcag
gaaattgccgcgtcgattgcggagatggcggccgcggtgcaggcctatgtcccgggatat
cgcctgaaacagcaggtgcagtttgaggtgattcccgaagataagccggtcaacctgccg
ggcattggccgcttctccggtctgaaaacggcggtttacctcgaggttgaaggggcggcg
cactatctgcctgcctacgcgggtaacctcgatattatgacctcggctgcgctggcgacg
gcggaaaaaatggcccagtcaatgaacgacgcggcgggagaagcagcatga

DBGET integrated database retrieval system