KEGG   Raoultella ornithinolytica: RORB6_07435Help
Entry
RORB6_07435       CDS       T02625                                 

Definition
Glu/Leu/Phe/Val dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
ror  Raoultella ornithinolytica
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RORB6_07435
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RORB6_07435
   00330 Arginine and proline metabolism
    RORB6_07435
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RORB6_07435
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     RORB6_07435
Exosome [BR:ror04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RORB6_07435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660742..1662016
Genome map
AA seq 424 aa AA seqDB search
MEKLSYASESSTSPWTTYLRQIDRVAPYLGDLAYWVETLRHPKRALIVDIPVQMDDGTIR
HFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCAAVNIPYGGAKGGVRVDP
FSLSEGELERLTRRYTSEIGLIIGPQKDIPAPDVGTNGKVMAWMMDTYSMNHGTTITGVV
TGKPIHLGGSLGREKATGRGVFITGREVAGRSGIEIEGAKVALQGFGNVGSEAARLFAEV
GARIVVIQDHTATLYNEGGIDMAALTAWQAEKKQIAGFPGAREIDKDAFWTTQMDILIPA
ALEGQITRERAEKLTCKLVLEGANGPTYPEADDVLAERGVVVVPDVICNAGGVTVSYFEW
VQDMASFFWSEEEINAKMDRIMTDAIIHVCEKAADKECSLRTAAYIVACERILMARKDRG
IYPG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttatcttacgcatctgaaagtagtacatctccatggacaacctacctgcgc
cagatcgaccgcgtcgcgccttacctgggcgatctcgcctactgggtggaaactctgcgt
cacccgaaacgcgcgctgattgtcgacattccggtgcagatggatgatggcactatccgt
cactttgaaggttaccgcgtacagcacaatctatcgcgtggaccgggtaaaggtggtgtt
cgctaccatccagacgttgacctgaacgaagtgatggcgctttctgcctggatgaccatt
aagtgcgccgcggtcaatattccttacggcggcgccaaaggcggcgtgcgcgttgacccg
ttcagcctgtcagaaggcgagctggagcgtctgacccgccgctataccagcgaaatcggt
ctgattatcgggccgcagaaagatattccggccccggacgtcggcaccaacggtaaagta
atggcgtggatgatggatacctattccatgaaccatggcaccacgattaccggcgtggtg
accggcaagccgattcacctcggcggttcgctgggacgtgaaaaagcgaccggtcgcggc
gtctttattaccggccgtgaagtcgccggccgttccggaattgaaattgaaggcgcgaaa
gtggcgctgcaaggttttggtaacgtcggtagcgaagccgctcgtctgttcgccgaagtg
ggcgcgcggatcgtggtgattcaggaccacaccgccaccctgtataacgaagggggcatt
gatatggccgccctgaccgcatggcaggctgagaagaagcagattgccggtttcccgggc
gcccgtgaaatcgacaaagatgccttctggaccacccagatggacattctgatccccgcc
gcgctggaaggccaaatcacgcgcgagcgcgcagaaaaactgacctgtaagctggtgctg
gaaggggcgaacggcccgacctatccggaagcggatgatgtccttgccgaacgcggtgtc
gtcgtggtgcctgacgttatctgtaacgccggcggcgtgaccgtcagctactttgaatgg
gtccaggatatggcgagcttcttctggagcgaagaagagatcaacgccaagatggaccgc
atcatgactgacgcgatcattcacgtttgcgagaaggccgcagacaaagagtgctctctg
cgtaccgcagcctatatcgtcgcctgtgaacgcattctgatggcgcgtaaagatcgcggt
atctacccaggctaa

DBGET integrated database retrieval system