KEGG   Raoultella ornithinolytica: RORB6_08485Help
Entry
RORB6_08485       CDS       T02625                                 

Gene name
katE
Definition
hydroperoxidase II (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
ror  Raoultella ornithinolytica
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RORB6_08485 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RORB6_08485 (katE)
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     RORB6_08485 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879229..1881484
Genome map
AA seq 751 aa AA seqDB search
MSDQNHKPQNHKAPHDGSESQPGLDALAPDDQSWRPTPHPTAPGEEPSAPGSLKAPDIHS
SKLDALAHQRKGSENVPLTTNQGVRIADDQNSLRAGNRGPTLLEDFILREKITHFDHERI
PERIVHARGSAAHGYFQPYRSLRDVTKADFLCDPARKTPVFVRFSTVQGGAGSADTVRDI
RGFATKFYTDEGIFDLVGNNTPIFFIQDALKFPDFVHAVKPEPHWAIPQGQSAHDTFWDY
VSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPLAGKASL
LWDESQKLTGRDPDFHRRDLWQAIEAGDYPEYELGLQLIPEEDEQAFDFDLLDPTKLIPE
ALVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGIDFSNDPLLQGRLFSYTDTQISR
LGGPNFHEIPINKPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAPKRGGF
ESYAERVDGEKIRQRSPSFAEYYAHPLLFWRSQTPAEQQHIIDAFSFELSKVVRVWIRER
VVDQLAHIDIPLAQAVGKNSGIALSDEQCKITPPPDVNGVKKDPSLSLYAIPGGEIKGRV
VAVLLNERPAAQDVLTLLQSLKAKGVHPRLLYSRMGEVIADDGTRLPISGTFSGSPSLTV
DAVIVPGGDMSLLSNSGELHYYLLEAYKHLKPIVLAGDGRQFKALLQVATQGEEGLVEAD
AIDAPAMDTLFTLMAAHRVWSRAGKTAAIPA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcagaaccataaaccacaaaaccacaaagcgcctcatgacggcagcgaatca
caacccggactggacgctctggctccggacgatcaatcatggcgcccgacgccgcatccc
acggctcccggagaagaacccagcgcgccgggaagcctcaaagcgcccgatatccacagt
agcaaacttgacgcgctggctcaccagcgcaaaggcagcgaaaacgtccccctgaccacc
aatcaaggggtacggattgccgacgatcagaattcgctccgcgcggggaaccggggcccc
acgctgctggaagactttattctgcgtgaaaaaataacccactttgaccatgagcggatc
ccggagcgaatcgtccatgcgcgcgggtcggcggcgcacggctattttcagccctatcgc
agcctgcgcgacgtgacgaaagcggattttctctgcgatcccgcgaggaaaaccccggta
ttcgtccgtttctctaccgtccagggcggcgccggctcggccgatacggtgcgcgatatt
cgcggcttcgccactaaattttataccgatgaaggcatttttgacctcgtcgggaacaac
acgccgatcttcttcatccaggatgcgctgaaattccccgatttcgttcatgcggtgaag
ccggaaccacactgggctatcccgcagggacaaagcgctcacgacaccttctgggattac
gtctctctacagccggaaacgttacacaacgtgatgtgggcaatgtccgatcgcggcata
ccgcgcagctatcgcaccatggaaggatttggtattcacaccttccgcctgatcaatgcc
gaaggtaaggctacctttgtccgttttcactggaaaccgctggccggtaaagcctctttg
ctctgggatgagtcgcaaaagctgaccggtcgggatccggatttccatcgccgcgatctg
tggcaagcgatagaagccggcgattatccggagtatgagctgggtctgcagttgatcccg
gaagaggatgaacaggcgtttgacttcgatctgctggatcccaccaagctgatccccgaa
gcgctggtcccggtacagagggtcgggaaaatggtgcttaaccgcaacccggataacttc
tttgccgaaaacgaacaggcggcgttccatccaggccatatcgtaccggggatagatttc
agcaacgacccgttactgcaggggcggctattttcgtataccgatacccagatcagccgg
ctgggtgggcctaatttccatgaaatcccgattaataaacccacctgcccgtatcacaac
ttccagcgcgatggcatgcaccggatggatattgataccaaccccgccaactacgagcca
aactcgatcaacgataactggccgcgcgaaacgccaccggcccctaagcgcggcggtttt
gagtcgtacgctgaacgcgtcgacggtgagaaaattcgccagcgtagcccctcgttcgcc
gagtattacgcccacccgctgctgttctggcgcagccagaccccggctgagcagcagcat
attattgatgcctttagcttcgagttaagcaaagttgtccgggtatggatccgcgaacgg
gtggtcgatcagctggcgcacatcgatatcccgctggcgcaggccgtcggcaaaaattca
ggcatcgcgctgagcgacgaacagtgcaagattaccccgccgccggacgtgaacggggtg
aaaaaggatcccagcctgagcctgtatgccatccccggcggggagatcaagggccgcgtc
gtcgccgtgctgctcaacgagcgcccggcagcgcaggatgtgctgaccctgctgcaatcc
ctgaaggcgaaaggggttcatccccgattgctttattcacggatgggagaagtgattgcc
gatgacggcacgcggctgcccatctccgggacctttagcggctcgccatcgctgacggtc
gatgcggtcatcgtcccgggtggcgacatgtcccttctcagcaacagcggggagctacat
tactacctgctggaggcctataagcatttaaaaccgatcgtgctggcgggcgacgggcgc
cagtttaaggctctgctgcaggtcgccactcagggggaggaaggacttgtcgaggcggac
gccattgacgctccggcgatggatacgctgttcacgctgatggccgcgcatcgggtgtgg
tcgcgcgccggcaaaacggcggcgattccggcctga

DBGET integrated database retrieval system