KEGG   Raoultella ornithinolytica: RORB6_16940Help
Entry
RORB6_16940       CDS       T02625                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ror  Raoultella ornithinolytica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ror00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ror00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ror00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3721620..3722966)
Genome map
AA seq 448 aa AA seqDB search
MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHVALMDIDATRLEESHIVVRKLMDSVG
ADGEISCHREQRTALKDADFVVVAFQIGGYQPCTVTDFEVCKLHGLEQTIADTLGPGGIM
RALRTIPHLWRICEDMTEVCPQATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELAHDLDLDPADLRYRCAGINHMAFYLSLEKKRADGSYVSIYPDMLQAFAEGRAPKHREN
SRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIERYQVPLDEYPKRCVEQV
ANWHKELEQYKTRERIEIKPSREYASTIMNAIWTGEPSVVYGNVRNEGLIDNLPQGCCVE
VACLVDANGIQPTKVGKLPAHLAALMQTNINVQTLLTEAILTEKRDYIYYATMMDPHTSA
ALGIEEIYALVDDLIASHGDWLPEWVHR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccaaaaattacgtttatcggcgctggctcaacggttttcgtcaaaaatatt
ctcggtgacgtttttcagcgcccggcgttgaaatcggcgcacgttgcgctgatggatatc
gatgcgacccgcctggaagagtcgcatattgtggtgcgtaagctgatggattccgtcggc
gccgacggtgaaattagctgccatcgcgagcagagaactgcgctgaaggatgcggatttt
gtggtggtggcttttcagattggcggctatcagccctgtaccgtcaccgattttgaagtc
tgtaagctgcatggtctggaacaaaccattgccgatacgctcggcccgggcggaatcatg
cgcgcattacgcaccattccgcacctgtggcgcatttgcgaggacatgacggaggtgtgc
ccgcaggcgaccatgctgaactatgttaatccgatggcgatgaatacctgggcgatgtat
gcgcgttatccgcatattaaacaggttgggttgtgccattcggtgcagggaacggcggaa
gagctggcgcacgatctcgatctcgacccggcggatttacgctatcgctgcgcgggcatc
aaccatatggcgttctatctgtcgctggagaaaaaacgcgcagacggcagctacgtcagc
atttatccggatatgctgcaggcctttgccgagggacgggcgccgaagcatcgggagaac
tcgcgctgccagaatattgttcgctatgagatgttcaaaaagctgggttacttcgtgacg
gagtcgtcagagcacttcgcggaatatacgccgtggtttatcaagccggggcgcgaagat
ctgattgaacgctatcaggtgccgctggatgaatatcccaaacgctgcgtggagcaggtg
gccaactggcacaaagagctggaacagtataaaacccgcgagcggattgagattaaaccc
tcccgcgagtatgccagcactattatgaacgccatctggaccggtgagccgagcgtcgtg
tacggtaacgtgcgcaacgaagggctcatcgacaacctgccgcaagggtgctgcgtggaa
gtggcctgtctggtggatgcgaacggtattcagcccaccaaagtcgggaagctgcctgcg
cacctggcggcgctgatgcagaccaacattaacgtccagactctgctgaccgaggccatt
cttaccgagaagcgggactacatctattatgccacgatgatggatccgcatacgtccgcg
gcgctgggcatcgaagagatttatgcgctggtggacgatttgattgccagccatggcgac
tggctaccggagtgggtacatcgttag

DBGET integrated database retrieval system