KEGG   Raoultella ornithinolytica: RORB6_16940Help
Entry
RORB6_16940       CDS       T02625                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ror  Raoultella ornithinolytica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RORB6_16940
  Lipid metabolism
   00561 Glycerolipid metabolism
    RORB6_16940
   00600 Sphingolipid metabolism
    RORB6_16940
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RORB6_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3721620..3722966)
Genome map
AA seq 448 aa AA seqDB search
MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHVALMDIDATRLEESHIVVRKLMDSVG
ADGEISCHREQRTALKDADFVVVAFQIGGYQPCTVTDFEVCKLHGLEQTIADTLGPGGIM
RALRTIPHLWRICEDMTEVCPQATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELAHDLDLDPADLRYRCAGINHMAFYLSLEKKRADGSYVSIYPDMLQAFAEGRAPKHREN
SRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIERYQVPLDEYPKRCVEQV
ANWHKELEQYKTRERIEIKPSREYASTIMNAIWTGEPSVVYGNVRNEGLIDNLPQGCCVE
VACLVDANGIQPTKVGKLPAHLAALMQTNINVQTLLTEAILTEKRDYIYYATMMDPHTSA
ALGIEEIYALVDDLIASHGDWLPEWVHR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccaaaaattacgtttatcggcgctggctcaacggttttcgtcaaaaatatt
ctcggtgacgtttttcagcgcccggcgttgaaatcggcgcacgttgcgctgatggatatc
gatgcgacccgcctggaagagtcgcatattgtggtgcgtaagctgatggattccgtcggc
gccgacggtgaaattagctgccatcgcgagcagagaactgcgctgaaggatgcggatttt
gtggtggtggcttttcagattggcggctatcagccctgtaccgtcaccgattttgaagtc
tgtaagctgcatggtctggaacaaaccattgccgatacgctcggcccgggcggaatcatg
cgcgcattacgcaccattccgcacctgtggcgcatttgcgaggacatgacggaggtgtgc
ccgcaggcgaccatgctgaactatgttaatccgatggcgatgaatacctgggcgatgtat
gcgcgttatccgcatattaaacaggttgggttgtgccattcggtgcagggaacggcggaa
gagctggcgcacgatctcgatctcgacccggcggatttacgctatcgctgcgcgggcatc
aaccatatggcgttctatctgtcgctggagaaaaaacgcgcagacggcagctacgtcagc
atttatccggatatgctgcaggcctttgccgagggacgggcgccgaagcatcgggagaac
tcgcgctgccagaatattgttcgctatgagatgttcaaaaagctgggttacttcgtgacg
gagtcgtcagagcacttcgcggaatatacgccgtggtttatcaagccggggcgcgaagat
ctgattgaacgctatcaggtgccgctggatgaatatcccaaacgctgcgtggagcaggtg
gccaactggcacaaagagctggaacagtataaaacccgcgagcggattgagattaaaccc
tcccgcgagtatgccagcactattatgaacgccatctggaccggtgagccgagcgtcgtg
tacggtaacgtgcgcaacgaagggctcatcgacaacctgccgcaagggtgctgcgtggaa
gtggcctgtctggtggatgcgaacggtattcagcccaccaaagtcgggaagctgcctgcg
cacctggcggcgctgatgcagaccaacattaacgtccagactctgctgaccgaggccatt
cttaccgagaagcgggactacatctattatgccacgatgatggatccgcatacgtccgcg
gcgctgggcatcgaagagatttatgcgctggtggacgatttgattgccagccatggcgac
tggctaccggagtgggtacatcgttag

DBGET integrated database retrieval system