KEGG   Raoultella ornithinolytica: RORB6_19690Help
Entry
RORB6_19690       CDS       T02625                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ror  Raoultella ornithinolytica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RORB6_19690
   00051 Fructose and mannose metabolism
    RORB6_19690
Enzymes [BR:ror01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RORB6_19690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4345910..4347232
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKTTNPLAFRHYNPDEMVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGSFNRPWQQPGEALEMAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLDNFA
RMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEEGELDKRVAKRYAGWNGDLGQQILKGQMTLTEIAQYAAQHNLAPQ
HQSGHQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctatttcgatcaactcgatcgcgttcgttatgaaggcccaaaaaccaccaac
ccgctcgcgttccgtcactataacccggacgagatggtgctgggcaagcgcatggaagag
catctgcggtttgccgcctgctactggcataccttctgctggaacggggcagatatgttt
ggcgtgggctccttcaatcgtccgtggcagcagccgggcgaggcgctggaaatggcgaaa
cgtaaagccgacgtcgcctttgagtttttccataagcttaatgtgccgtactactgcttc
catgatgtggatgtctctccggaaggggcgtcgttgaaggagtatctggacaattttgcc
cggatggtcgatgtcctggcggcgaagcaagaacagagcggcgtgaagctgctgtggggg
acggcaaactgctttaccaacccgcgttacggcgctggagcggcaaccaacccggatcca
gaggttttcagctgggcggcgactcaggtggtgaccgccatgaatgccacacacaaactg
ggcggggaaaactatgttctgtggggcggccgcgaaggctacgaaaccctgctcaatacc
gatctgcgccaggagcgcgagcaaattggtcgctttatgcagctggtggtggaacacaaa
cataaaatcggcttccagggcacgctgctgattgagccaaaaccgcaggaaccgaccaaa
catcagtacgattatgatgcctctaccgtctacggtttcctcaagcagtttggcctcgaa
aaagagatcaaactgaatatcgaagcgaaccatgcgaccctggccggacactccttccac
catgagattgcgaccgctattgcgctgggtctgttcggctccgtggatgccaaccgcggc
gatccgcagctgggctgggataccgatcagttcccgaacagcgtggaagagaatgccctg
gtgatgtatgaaattcttaaagccggtggctttaccaccggcggcctgaattttgatgcc
aaagttcgtcgtcagagcaccgataaatacgatctgttctatggtcatattggggcgatg
gatacgatggcgctgtctctgaaagtggcggcccgtatgatcgaagagggcgagctggat
aagcgggtcgcgaaacgctatgccggctggaatggcgacctgggtcagcaaatcctgaaa
gggcagatgacgctgacggagattgcgcagtacgcggcgcagcataatctggctccccag
catcagagcggccatcaggagcagctggaaaacctggttaaccattatctctttgataag
taa

DBGET integrated database retrieval system