KEGG   Raoultella ornithinolytica: RORB6_19870Help
Entry
RORB6_19870       CDS       T02625                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ror  Raoultella ornithinolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ror00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4391218..4392210
Genome map
AA seq 330 aa AA seqDB search
MSLRVVIAVMVTMVLLPRAWADTAWESYKSRFMMADGRIVDTGNGNVSHTEGQGFAMLLA
VAKNDRPAFDKLWQWTDKTLRNKDNGLFYWRYNPVAPDPIADKNDATDGDTLIAWALLRA
QQQWGDKSYGNASDAITASLLKNTVVTFAGYQVMLPGAKGFNRNDHLNLNPSYFIFPAWQ
AFAARTHLIAWRKLQSDAQALLGKMAWGKTQLPTDWVALKADGKMEPAKEWPPRMSYDAI
RIPLYLTWANPQSPLLTPWKNWFQSYPRLQTPAWINVSTNNVSPWFMTGGLLAVRDLTMG
ETPEDPQITAQDDYYSASLKLLVWLAGRDR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcgtgttgtaatcgcagtcatggtgacgatggtgctgctgccccgcgcgtgg
gcagacaccgcctgggaaagctataaatcgcgttttatgatggctgacgggcgcattgtg
gatacgggcaacggtaacgtttcgcataccgaggggcagggattcgcgatgctgctggcg
gtggcgaaaaacgatcggccggccttcgacaagctatggcaatggaccgataaaacgcta
cgcaataaagacaacgggctcttttactggcgctataaccctgtggcgccggaccctatt
gccgataagaacgatgccaccgacggcgataccctgattgcatgggcgctgctgcgcgca
cagcagcagtggggggacaaatcctacggtaacgcgtctgatgccattaccgcatcgctg
ctgaaaaatacggtggtgacctttgccggctatcaggtcatgctgcctggcgccaaaggc
ttcaaccgcaacgaccatctcaatcttaacccctcctactttatcttcccggcatggcag
gcgtttgccgcgcgcacgcatctgatcgcctggcgtaagctgcaaagcgacgctcaggcg
ctgctgggcaaaatggcatggggcaaaacccagctccctaccgactgggttgcgctgaaa
gctgacggtaagatggagccggcgaaagagtggccgccgcggatgagctatgacgcgatt
cgtatcccgctgtatctcacctgggccaatccacagagcccgctgctgacgccgtggaaa
aactggttccagagctatccgcggctgcaaacgccggcgtggattaacgtcagcaccaat
aacgtctcgccgtggtttatgaccggcggcctgctggcggtgcgcgatctgaccatgggc
gagacgccggaggatccgcaaattaccgcccaggatgattactactccgccagcctgaaa
ctgctggtctggctggcagggcgcgatcggtaa

DBGET integrated database retrieval system