KEGG   Raoultella ornithinolytica: RORB6_19870Help
Entry
RORB6_19870       CDS       T02625                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ror  Raoultella ornithinolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RORB6_19870
Enzymes [BR:ror01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RORB6_19870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4391218..4392210
Genome map
AA seq 330 aa AA seqDB search
MSLRVVIAVMVTMVLLPRAWADTAWESYKSRFMMADGRIVDTGNGNVSHTEGQGFAMLLA
VAKNDRPAFDKLWQWTDKTLRNKDNGLFYWRYNPVAPDPIADKNDATDGDTLIAWALLRA
QQQWGDKSYGNASDAITASLLKNTVVTFAGYQVMLPGAKGFNRNDHLNLNPSYFIFPAWQ
AFAARTHLIAWRKLQSDAQALLGKMAWGKTQLPTDWVALKADGKMEPAKEWPPRMSYDAI
RIPLYLTWANPQSPLLTPWKNWFQSYPRLQTPAWINVSTNNVSPWFMTGGLLAVRDLTMG
ETPEDPQITAQDDYYSASLKLLVWLAGRDR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcgtgttgtaatcgcagtcatggtgacgatggtgctgctgccccgcgcgtgg
gcagacaccgcctgggaaagctataaatcgcgttttatgatggctgacgggcgcattgtg
gatacgggcaacggtaacgtttcgcataccgaggggcagggattcgcgatgctgctggcg
gtggcgaaaaacgatcggccggccttcgacaagctatggcaatggaccgataaaacgcta
cgcaataaagacaacgggctcttttactggcgctataaccctgtggcgccggaccctatt
gccgataagaacgatgccaccgacggcgataccctgattgcatgggcgctgctgcgcgca
cagcagcagtggggggacaaatcctacggtaacgcgtctgatgccattaccgcatcgctg
ctgaaaaatacggtggtgacctttgccggctatcaggtcatgctgcctggcgccaaaggc
ttcaaccgcaacgaccatctcaatcttaacccctcctactttatcttcccggcatggcag
gcgtttgccgcgcgcacgcatctgatcgcctggcgtaagctgcaaagcgacgctcaggcg
ctgctgggcaaaatggcatggggcaaaacccagctccctaccgactgggttgcgctgaaa
gctgacggtaagatggagccggcgaaagagtggccgccgcggatgagctatgacgcgatt
cgtatcccgctgtatctcacctgggccaatccacagagcccgctgctgacgccgtggaaa
aactggttccagagctatccgcggctgcaaacgccggcgtggattaacgtcagcaccaat
aacgtctcgccgtggtttatgaccggcggcctgctggcggtgcgcgatctgaccatgggc
gagacgccggaggatccgcaaattaccgcccaggatgattactactccgccagcctgaaa
ctgctggtctggctggcagggcgcgatcggtaa

DBGET integrated database retrieval system