KEGG   Raoultella ornithinolytica B6: RORB6_20445Help
Entry
RORB6_20445       CDS       T02625                                 

Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ror  Raoultella ornithinolytica B6
Pathway
ror00500  Starch and sucrose metabolism
ror01100  Metabolic pathways
ror01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ror00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RORB6_20445
Enzymes [BR:ror01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RORB6_20445
Exosome [BR:ror04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RORB6_20445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AGJ88769
Position
4518817..4521003
Genome map
AA seq 728 aa AA seqDB search
MSNRIDRDVINALISGHFADPFSVLGMHQTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFSGVLPRRKNPFRYQLAVTWHGQQNLIDDPYRFGPLLQDLDVWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFVP
GAHNGQLYKFELIDAHGHLRVKSDPYAFEAQMRPESASLICGLPEKVEQPQSRKQANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREDFRYFLNAAHAAGLNVILDWVPGHFPSDDFALASFDGTALYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWVPNEYGGRENLEAIEFLRNTNRVLGEQTPGAVTMAEESTDFAGVSRPSSTGGLGFWFK
WNLGWMHDTLDYMKLDPIYRRHHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMFAFPGKKLLFMGNEFAQGREWNHDGSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFIFVRRDKAGNEIIVASNFTPV
PRYGYRFGINQPGRWREELNTDSMHYHGSNTGNGGIVESEAIASHGREHSLSITLPPLAT
VWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcgtatcgatagagacgtgattaatgcgcttatttctggccattttgcggat
cccttttccgtacttggaatgcatcaaaccgatgccggtctggaagtgcgcgcattatta
cccgatgccaccgatgtatgggttattgaaccgaaaaccgggcgcaaagtcggcaaactc
gaatgcctcgactcacgcggattctttagcggcgtactgccgcgccgaaaaaatcctttt
cgttaccagctggccgtcacctggcacggtcagcaaaacctgattgacgacccttatcgc
tttggtccgctgctgcaggatcttgatgtctggctgctgtcagaaggcactcatctacgg
ccttatgaaacgctgggggcacacgccgacacgatggacggcgtcaccggcacgcgcttt
tccgtctgggcgccgaacgcccgtcgggtttccgttgtcggacagttcaactactgggat
ggccgccgtcatccgatgcgcctgcgcaaagagtccggcatctgggagctgtttgtgccc
ggcgcgcataatggccagctgtataaatttgaactgattgacgcccacggccatctgcgc
gtgaagtccgacccttatgcctttgaagcgcaaatgcgcccggaaagcgcgtcgcttatc
tgcggcctgccggaaaaggtcgaacagccgcagtcccgtaagcaggccaaccagtttgat
gcgccgatttcgatctatgaagtccatttgggctcctggcgtcgccataccgataacaac
ttctggctgagctaccgtgaactggccgatcagctggtgccctacgcgaagtggatgggc
ttcacccatctggagctgctgccggtaaacgaacatccgttcgacggcagctggggctat
cagccgaccgggctgtacgcgccgacccgccgttttggtacccgtgaagacttccgctac
ttcctgaatgctgcccatgccgcgggtctgaacgtgattctcgactgggtgccgggccac
ttcccgtcggatgactttgcgctggcatcgttcgacggcaccgcgttgtatgaacacagc
gacccgcgagaaggttatcaccaggactggaatacgctgatctacaactacggtcgtcgg
gaagtcagcaacttcctggtcgggaacgcgctgtactggattgagcgcttcgggatcgac
gccctgcgcgtggatgcggttgcgtcaatgatctaccgcgactacagccgcaaagagggg
gagtgggtgcccaatgagtacggcggccgggaaaacctcgaagcgattgaatttctgcgc
aataccaaccgtgtgctcggtgaacagacgccgggagcggtcacgatggcggaggagtct
accgacttcgccggggtttcacgaccgtcttcgacgggcggtcttggcttctggttcaaa
tggaacctcggctggatgcatgacaccctcgactacatgaagctcgatcccatctatcgt
cgtcatcatcacgacaagatgaccttcgggatgctctacaactacaccgaaaacttcgtg
ctgccgctgtcacacgatgaagtggttcacggcaaaaaatcgattcttgaccggatgccc
ggcgatgcctggcagaagtttgccaacctgcgcgcctactatggctggatgtttgccttc
ccggggaaaaaactgctgtttatgggcaatgaatttgcccaggggcgggagtggaaccac
gacggtagccttgactggcatctgctggaaggcggcgataactggcatcacggcgtccag
cgcctggtacgcgatctgaaccatacctatcgccaccataaagcgctgcacgagctggat
tttgacccctacggctttgaatggctggtggtggatgatcacgaacgttctgtctttatc
tttgtgcgccgtgataaagccggcaatgagattatcgttgccagcaacttcacgccggtg
ccgcgctacggctatcgtttcgggattaaccagccggggcgctggcgtgaagaactgaat
accgactcgatgcactaccacggtagcaacaccggtaacggcggcatcgtggaaagcgaa
gccatcgccagccacgggcgtgagcattctctctcgattacgctaccgccgctggcgacc
gtctggctggtacgggaggcagaatga

DBGET integrated database retrieval system