KEGG   Raoultella ornithinolytica: RORB6_22895Help
Entry
RORB6_22895       CDS       T02625                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ror  Raoultella ornithinolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5012507..5013220
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAATLSGAAHADNAAIKQSLAKLGVQNTDIQPSPVAGMSTVLTDSGVLYV
TDDGKHVIQGPMYDVGGAQPVNVTNALLVGKLNALEKEMIIYKAPQEKHVITVFTDITCG
YCHKLHEEMSDYNALGITVRYLAFPRQGLQSQTEQDMKAIWCAKDRNKALDDAMSGKGIQ
PASCQVDISKHYTLGVQFGVNGTPAMVLSNGYVLPGYQGPKELKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgtttacgctgctggcggcgacgctgtccggtgcggcccat
gcggataacgcggctatcaaacagtcgctggctaaactgggcgtacagaatacggatatt
cagccatcgccggttgccggaatgagcaccgtactgaccgacagcggcgtgctgtatgtg
accgatgacggtaaacacgtcatccaggggccgatgtatgatgtcggcggcgcacagccg
gtaaacgtcaccaacgcgctgctggtgggcaagctgaacgcgctggaaaaagagatgatt
atctataaagcgccgcaggaaaaacacgttatcaccgttttcaccgacatcacctgcggc
tactgccacaagctgcacgaagagatgagcgactataacgcgctgggaattaccgttcgc
tacctggccttcccgcgccagggcctgcaaagccagaccgagcaggatatgaaagccatc
tggtgcgccaaagatcgtaacaaagcgctggatgacgcgatgagcggtaaaggtattcag
ccggcgagctgccaggtcgatatcagcaaacactacacgcttggcgtgcagttcggcgtt
aacggcacgccggcgatggtgctgagcaacggctacgtacttccgggttatcaggggccg
aaagagctgaaagccttccttgatgagcatcaaaaacagacaagcggtaaataa

DBGET integrated database retrieval system