KEGG   Raoultella ornithinolytica: RORB6_23525Help
Entry
RORB6_23525       CDS       T02625                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ror  Raoultella ornithinolytica
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ror00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5151256..5151903
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYDGGMLITPTGIPYEKLTESHIVWIDA
NGQHEQGKLPSSEWRFHMAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEFVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacggaacagactggcgcggcagattattgatacctgcctggaaatgacccggctg
gggctgaatcagggcaccgccgggaacgtaagcgtgcgttatgacgggggaatgctgatt
acgccgacgggtattccttatgaaaaacttactgaatctcacatcgtgtggatcgatgcc
aacggtcagcacgagcaggggaaactgccgtcgagcgagtggcgttttcatatggccgcc
taccagacccggcccgatgcacaggccgtggtgcataatcacgcggtgcactgcacggcg
gtatcgatcctcaatcgcccgatcccggcgatccactacatgattgctgctgccgggggg
aactccattccctgtgcgccatacgccacctttgggacccgcgagctgtcagagtttgtc
gccgtggcgttaaaaaaccgcaaagcgacgctgctgcagcaccatggcctgattgcctgc
gaagagaatctggaaaaagcgctgtggctggcgcatgaggtcgaggttctggcgcagctc
tatctcagtaccctggcgatcgtcgatcctgttccggtgctggacgacgaggccattgcc
atcgtactggaaaaattcaaaacctacgggttacgtatcgaagagtga

DBGET integrated database retrieval system