KEGG   Rhodopseudomonas palustris CGA009: RPA0069Help
Entry
RPA0069           CDS       T00153                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA0069 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA0069 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA0069 (trpB)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPA0069 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
74840..76054
Genome map
AA seq 404 aa AA seqDB search
MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEAKADPAFRAEMDNHLK
HYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAE
TGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVREQIMQAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASIAGGKPGVLHGNRTYLLMDA
DGQIEEAHSISAGLDYPGVGPEHSWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEHLGGKF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctttgccgaattccttccggtccggccccgacgagcgcgggcatttcggt
atctatggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgatctggaaaag
gcctatgcggaagccaaggccgacccggcgttccgcgccgagatggacaaccatctcaag
cactatgtcggacgtccgtcggctttgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaagacctcaaccacaccggcgcccacaaggtgaac
aacgtgctcggccagatcatgctggccaagcgcatgggcaagcctcgggtgatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgccaagttcggtctcgaa
tgcgtggtgttcatgggcgcggtcgacgtcgaacgccagcagcccaacgtgctgcggatg
aaggcgctcggcgcagaagtccgccccgtcacctccggcgccaacacgctgaaggacgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacgacaccttttactgcatcggt
acggtcgcgggtccgcatccctatccgatgatggtgcgcgacttccaggcggtgatcggt
caggaagtccgcgagcagatcatgcaggccgaaggccgcctgcccgactcgctggtggcc
tgcatcggcggcggctccaacgcgatggggcttttccatccgttcctcgacgacccgggc
gtcgcgatctacggcgtcgaagccgcgggccatgggctcgacaagctgcacgcggcatcg
attgccggcggcaagccgggcgtgctgcacggcaaccgcacctatctgctgatggatgcg
gacggccagatcgaagaagcgcattcgatctccgccggcctcgactatccgggcgttggc
cccgagcactcctggctgcacgacgtcggccgcgtcaacttcctgtccgcgaccgacacc
gaagcgctcgacgcgttcaagctgtgctgccggctcgaaggcatcatcccggcgctggag
ccgagccatgcgctggccaaggtcgccgacctcgcacccaagctgccgaaagatcacctg
atggtcgtcaacatgtccggccgcggcgacaaggacctcgcgtcggtcgccgaacatctc
gggggcaaattctga

DBGET integrated database retrieval system