KEGG   Rhodopseudomonas palustris CGA009: RPA0069Help
Entry
RPA0069           CDS       T00153                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rpa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rpa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
74840..76054
Genome map
AA seq 404 aa AA seqDB search
MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEAKADPAFRAEMDNHLK
HYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLGQIMLAKRMGKPRVIAE
TGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKALGAEVRPVTSGANTLKDA
MNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQEVREQIMQAEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASIAGGKPGVLHGNRTYLLMDA
DGQIEEAHSISAGLDYPGVGPEHSWLHDVGRVNFLSATDTEALDAFKLCCRLEGIIPALE
PSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEHLGGKF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctttgccgaattccttccggtccggccccgacgagcgcgggcatttcggt
atctatggcggccgcttcgtcgccgagacgctgatgccgctgatcctcgatctggaaaag
gcctatgcggaagccaaggccgacccggcgttccgcgccgagatggacaaccatctcaag
cactatgtcggacgtccgtcggctttgtatttcgccgagcggctgaccgagcatttcggc
ggcgccaagatctacttcaagcgcgaagacctcaaccacaccggcgcccacaaggtgaac
aacgtgctcggccagatcatgctggccaagcgcatgggcaagcctcgggtgatcgccgag
accggcgccggcatgcacggcgtcgccaccgcgacgatgtgcgccaagttcggtctcgaa
tgcgtggtgttcatgggcgcggtcgacgtcgaacgccagcagcccaacgtgctgcggatg
aaggcgctcggcgcagaagtccgccccgtcacctccggcgccaacacgctgaaggacgcg
atgaacgaggcgctgcgtgactgggtcaccaacgtccacgacaccttttactgcatcggt
acggtcgcgggtccgcatccctatccgatgatggtgcgcgacttccaggcggtgatcggt
caggaagtccgcgagcagatcatgcaggccgaaggccgcctgcccgactcgctggtggcc
tgcatcggcggcggctccaacgcgatggggcttttccatccgttcctcgacgacccgggc
gtcgcgatctacggcgtcgaagccgcgggccatgggctcgacaagctgcacgcggcatcg
attgccggcggcaagccgggcgtgctgcacggcaaccgcacctatctgctgatggatgcg
gacggccagatcgaagaagcgcattcgatctccgccggcctcgactatccgggcgttggc
cccgagcactcctggctgcacgacgtcggccgcgtcaacttcctgtccgcgaccgacacc
gaagcgctcgacgcgttcaagctgtgctgccggctcgaaggcatcatcccggcgctggag
ccgagccatgcgctggccaaggtcgccgacctcgcacccaagctgccgaaagatcacctg
atggtcgtcaacatgtccggccgcggcgacaaggacctcgcgtcggtcgccgaacatctc
gggggcaaattctga

DBGET integrated database retrieval system