KEGG   Rhodopseudomonas palustris CGA009: RPA0070Help
Entry
RPA0070           CDS       T00153                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA0070 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA0070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPA0070 (trpA)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPA0070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
76054..76890
Genome map
AA seq 278 aa AA seqDB search
MTTRIDTRFGELKQQGRPALVTFVMAGDPDLDTSLQILKVLPAAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLGLVRDFRATDNATPLVLMGYYNPIYIYGVDAFLADAK
AAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKRLPAVLANTSGFVYYVSI
TGITGSASADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQAIAAQANGAVVGSALIDA
LKASLNAEGRATKATVGAVADLVASLAAGVRGAKQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcatagacacccgcttcggcgagctgaagcagcagggccgcccggcactc
gtcaccttcgtgatggcgggcgatcccgatctcgacacctcgctgcagatcctcaaggtg
ctgccggccgcaggcgccgacgtgatcgaaatcggcatgccgttcaccgacccgatggcg
gatggtccggcgatccaggccgccggcctgcgcgcgttgaaagccggcaccacgctgaag
aagacgctggggctggtccgcgacttccgcgccaccgacaatgccaccccgctggtgctg
atggggtattacaacccgatctacatctacggcgtcgatgccttcctggcggatgccaag
gcggccggcgtcgacggcctgatcatcgtcgacctgccgccggaagaggacgaggagctg
tgcttgccggccatgaaggccgggctcaacttcatccgcctcgccaccccgaccaccgac
gaaaagcggttgccggcggtgctcgccaacacttcgggcttcgtctattacgtctcgatc
accggcatcaccggatcggcctcggcggatgcctcggcggtcggcgccgcggtgcagcgg
atcaagcgtcacaccaacctgccggtctgcgtcggcttcggcatccgcacgccggatgcg
gcgcaagcgatcgccgcgcaggcgaacggcgcggtggtgggctcggcgctgatcgatgcg
ctcaaggccagcctcaacgccgagggccgcgccaccaaggccacggtcggtgcagtggcg
gatctggtcgcctcgctcgcggccggcgttcgcggtgcgaaacaggctgcggaatag

DBGET integrated database retrieval system