KEGG   Rhodopseudomonas palustris CGA009: RPA0118Help
Entry
RPA0118           CDS       T00153                                 

Gene name
rmlC
Definition
dTDP-6-deoxy-D-glucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RPA0118 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPA0118 (rmlC)
Enzymes [BR:rpa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RPA0118 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
133329..133886
Genome map
AA seq 185 aa AA seqDB search
MLTVTSTAIEAVKIITPRAFADSRGSFVETYNRQRFVDHGVALEFVQDNQSISAAVGTVR
GLHFQSAPFAQDKLVRVAKGRILDVAVDLRRSSPTYGQWVAEELSAEDGKQLLIPIGFAH
GFCTLEPDTVVAYKVTNYYSPPHDLGIAWNDPDLAVRWPVTADQAVLSDKDLELPPFASL
PNYFE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagtgacgtccaccgcaatcgaagcggtgaagattatcacgcccagagcgttc
gcggattcccgcggctcgttcgtagaaacctacaacaggcagcgcttcgtcgatcacggt
gttgcgctcgaattcgtccaggacaaccaatcgatttcggcggcagtcggcaccgttcgc
gggctgcacttccagagcgcgccgtttgcgcaggacaagctggtgcgagtggcgaagggc
cgtatcctcgacgttgcagtcgatttgcgccgttcatcgccgacctacggccaatgggtc
gccgaggaattgtccgccgaggacggcaagcagttgctgattccgatcggtttcgcccac
ggcttctgcaccctcgaacccgacacggtggtggcctacaaggtgaccaactactattcg
ccgccgcatgatctcggcatcgcctggaacgatcccgatcttgcggtacgctggcctgtc
actgccgatcaggcggtgctgtcggacaaggatctggagctgccgccgttcgcgtcactg
ccgaattacttcgagtag

DBGET integrated database retrieval system