KEGG   Rhodopseudomonas palustris CGA009: RPA0137Help
Entry
RPA0137           CDS       T00153                                 

Gene name
cheB1
Definition
chemotaxis methylesterase CheB1
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA0137 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RPA0137 (cheB1)
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RPA0137 (cheB1)
Two-component system [BR:rpa02022]
 CheA family
  CheA-CheYBV
   RPA0137 (cheB1)
Bacterial motility proteins [BR:rpa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RPA0137 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(155814..156905)
Genome map
AA seq 363 aa AA seqDB search
MAKQKIRVLIVDDSASVRQVLGTILAEDPEIEVIGTASDPFVAAKRLQNELPDVILLDIE
MPRMDGITFLRKIMAQHPIPVVICSSLTPEGSDLMFEALEAGAVDIVPKPRVDTRQALME
SSGRLREAIKSAARARVRPRAARKVIEQKLTADAIIPPPVAGRSRPTTERIVCIGVSTGG
TEALYDVLEVLPPNCPGILIVQHMPQGFTAAFAKRLNAGCQINVKEAEDGDPVLPGWAYI
APGARHMLLVRSGLRYQIAIKDGPPVSRHRPSADVLFRSAAQYAGANALGIIMTGMGDDG
ARGLLEMRKLGAYTCAQDEESCVVFGMPKEAIACGAVEKVVSLNQIPREIMAWQQAKQPA
SAD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagaagattagagtcctgatcgtcgacgactccgcctcggtgcgacaggtc
ctcggcaccattctggccgaagaccccgagatcgaagtgatcggaaccgcgtccgatccg
ttcgtggcggcgaagcggctgcagaacgaacttcccgacgtcatcctgctcgatatcgag
atgccgcggatggacggcatcacattcctccgcaagatcatggcgcagcatccgatcccg
gtggtgatctgctcgtcactgacgcccgaagggtccgacctgatgttcgaggcgctcgag
gcgggcgccgtcgatatcgtgcccaagccgcgggtcgacacccgccaggcgctgatggag
agctccggccgcctgcgcgaagccatcaagtcggcagcccgcgctcgtgtccgcccccgc
gctgcccgcaaggtgattgaacagaagctgacggccgatgcgatcatcccgcctccggtt
gccgggcggtcgcgcccgaccaccgagcggatcgtgtgcatcggggtgtcgaccggcggt
accgaagcgctttacgacgtgctcgaagtgctaccgccgaactgccccggcatcctgatc
gtgcagcacatgccgcagggcttcaccgctgcattcgccaagcggctcaatgccggctgc
cagatcaacgtcaaggaagccgaggacggcgatccggtgctgccgggctgggcctatatc
gcgcccggcgcccggcacatgctgctggtccgcagcggcctgcgctatcagattgccatc
aaggacggcccgccggtgtcgcggcaccgtccctcggctgacgtcctgtttcgatcggcc
gcccaatatgccggcgccaacgcgctcggcatcatcatgaccggcatgggtgacgacggc
gcccgcggtctgctcgagatgcgcaagctcggcgcctacacctgcgcgcaggacgaagag
agctgcgtcgtattcggtatgccgaaggaagcgatcgcctgcggcgccgtcgagaaggtt
gtgtcgctgaaccagatcccgcgcgagatcatggcctggcaacaagccaagcagccggcc
tcagcggattga

  All links  
No link information was found.   
DBGET integrated database retrieval system