KEGG   Rhodopseudomonas palustris CGA009: RPA0137Help
Entry
RPA0137           CDS       T00153                                 

Gene name
cheB1
Definition
chemotaxis methylesterase CheB1
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rpa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(155814..156905)
Genome map
AA seq 363 aa AA seqDB search
MAKQKIRVLIVDDSASVRQVLGTILAEDPEIEVIGTASDPFVAAKRLQNELPDVILLDIE
MPRMDGITFLRKIMAQHPIPVVICSSLTPEGSDLMFEALEAGAVDIVPKPRVDTRQALME
SSGRLREAIKSAARARVRPRAARKVIEQKLTADAIIPPPVAGRSRPTTERIVCIGVSTGG
TEALYDVLEVLPPNCPGILIVQHMPQGFTAAFAKRLNAGCQINVKEAEDGDPVLPGWAYI
APGARHMLLVRSGLRYQIAIKDGPPVSRHRPSADVLFRSAAQYAGANALGIIMTGMGDDG
ARGLLEMRKLGAYTCAQDEESCVVFGMPKEAIACGAVEKVVSLNQIPREIMAWQQAKQPA
SAD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagaagattagagtcctgatcgtcgacgactccgcctcggtgcgacaggtc
ctcggcaccattctggccgaagaccccgagatcgaagtgatcggaaccgcgtccgatccg
ttcgtggcggcgaagcggctgcagaacgaacttcccgacgtcatcctgctcgatatcgag
atgccgcggatggacggcatcacattcctccgcaagatcatggcgcagcatccgatcccg
gtggtgatctgctcgtcactgacgcccgaagggtccgacctgatgttcgaggcgctcgag
gcgggcgccgtcgatatcgtgcccaagccgcgggtcgacacccgccaggcgctgatggag
agctccggccgcctgcgcgaagccatcaagtcggcagcccgcgctcgtgtccgcccccgc
gctgcccgcaaggtgattgaacagaagctgacggccgatgcgatcatcccgcctccggtt
gccgggcggtcgcgcccgaccaccgagcggatcgtgtgcatcggggtgtcgaccggcggt
accgaagcgctttacgacgtgctcgaagtgctaccgccgaactgccccggcatcctgatc
gtgcagcacatgccgcagggcttcaccgctgcattcgccaagcggctcaatgccggctgc
cagatcaacgtcaaggaagccgaggacggcgatccggtgctgccgggctgggcctatatc
gcgcccggcgcccggcacatgctgctggtccgcagcggcctgcgctatcagattgccatc
aaggacggcccgccggtgtcgcggcaccgtccctcggctgacgtcctgtttcgatcggcc
gcccaatatgccggcgccaacgcgctcggcatcatcatgaccggcatgggtgacgacggc
gcccgcggtctgctcgagatgcgcaagctcggcgcctacacctgcgcgcaggacgaagag
agctgcgtcgtattcggtatgccgaaggaagcgatcgcctgcggcgccgtcgagaaggtt
gtgtcgctgaaccagatcccgcgcgagatcatggcctggcaacaagccaagcagccggcc
tcagcggattga

DBGET integrated database retrieval system