KEGG   Rhodopseudomonas palustris CGA009: RPA0163Help
Entry
RPA0163           CDS       T00153                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00330  Arginine and proline metabolism
rpa00332  Carbapenem biosynthesis
rpa01100  Metabolic pathways
rpa01130  Biosynthesis of antibiotics
rpa01230  Biosynthesis of amino acids
Module
rpa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RPA0163 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RPA0163 (proB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RPA0163 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA PPV_E2_C
Motif
Other DBs
NCBI-ProteinID: CAE25607
CyanoBase: RPA0163
CYORF: RPA0163
UniProt: Q6NDE5
Position
181888..183018
Genome map
AA seq 376 aa AA seqDB search
MASPKLHDFRHIVVKVGSSLLIDSAAGEVRAGWLAALAADIAELHRGGRDVMVVSSGSIA
LGRSRLKLPRGPLKLEESQAAAAVGQIELARTWSEVLGAHGIGAGQILVTFQDTEERRRY
LNARSTIAKLLEWRAVPVINENDTVATTEIRYGDNDRLAARVATMASADLLILLSDIDGL
YTAPPGSNPDATLIPVVEAITAEIEGMAGAAGSELSRGGMRTKIEAAKIATSAGTHMLIA
SGKIDHPLKAIADGGKCTWFLTPANPVTARKRWIAGTLEPKGTLTIDAGAVSALRAGKSL
LPAGVIRVDGQFSRGDAVIVRGPDTHEIGRGLVAYDAEDAEKIKGHSSPDVMMILGITGR
AEMIHRDDLVVGTAPT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccagccctaagcttcacgatttccgccacatcgtcgtcaaggtcggctcgtcgctg
ctgatcgactccgccgccggcgaggtgcgggccgggtggctggcggcgctcgccgccgac
attgccgagctgcatcgtggcggcagggacgtgatggtggtgtcgtcgggctcgatcgcg
ctcggacggagccggctgaagctgccgcgcggcccgctcaagcttgaggaaagccaggcc
gccgcggcggtcgggcaaatcgaactggcgcggacctggtcggaagtgctcggcgcccat
ggcatcggcgccggccagattctggtgacgttccaggacaccgaagagcggcggcgctat
ctcaacgcccgctcgaccatcgccaagctgctggaatggcgagcggtgccggtgatcaac
gaaaacgacaccgtcgccaccaccgagattcgctacggagataacgaccggcttgcggcg
cgggtcgccaccatggcgagcgccgatctgctgatcctgctgtccgacattgacgggctg
tacaccgcgccgcccggcagcaatccggacgccacgctgattcctgtcgtcgaagcgatc
accgccgagatcgagggcatggccggggcggcaggctcggagctgtcgcgcggcggcatg
cgcaccaagatcgaggcggccaagatcgcgacctccgctggcactcatatgctgatcgcc
tccggcaagatcgatcatccgctcaaagcgatcgccgacggcggcaagtgcacttggttc
ctgacgccggccaatccggtgacggcgcggaagcgctggattgccggcacgctggagccg
aagggcacgctgacgatcgatgccggcgcagtcagcgcgctgcgcgccggcaagagcctg
ctgccggccggcgtgatccgggtcgacggtcaattttcccgcggcgacgccgtgatcgtg
cgcggcccggacacccatgagatcggccgcggcctggtcgcttacgacgccgaggatgcc
gagaagatcaaaggccactcgtcgccggacgtgatgatgatcctcggaatcaccggccgc
gccgagatgatccatcgcgacgatctagtcgtcggaacggcgccgacctga

DBGET integrated database retrieval system