KEGG   Rhodopseudomonas palustris CGA009: RPA0188Help
Entry
RPA0188           CDS       T00153                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyl transferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00020  Citrate cycle (TCA cycle)
rpa00310  Lysine degradation
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
Module
rpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPA0188 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RPA0188 (sucB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPA0188 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CAE25632
CyanoBase: RPA0188
CYORF: RPA0188
UniProt: Q6NDC0
Position
complement(208123..209376)
Genome map
AA seq 417 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVAVGALLGQITDGAAPAKPAAAAPAKAAAPAAAPAPAAPAPAAAPAAKAPPSDAP
LAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRGPS
PADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFEKKH
GAKLGFMGFFTKACVQALKDIPAVNAEMDGTDLIYKNYYHIGVAVGTDKGLVVPVVRDCD
EKSIADIEKSIVDYGKRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGM
HKIQERPVVIGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccgacgctcggtgaatcggtgaccgaggcgaccatcggccgc
tggttcaagaagcctggcgaggcggtggctgtcgatgagccgctcgtcgagctcgaaacc
gacaaggtgaccattgaagtgccggccccgtcggccggtacgctcggcgaaatcgtcgcc
aaggacggcgagaccgtcgcggtcggcgcgttgctcggccagatcaccgatggcgccgcc
ccggccaagccggctgccgctgctccggcgaaggccgcggcaccggctgctgcgcctgcc
ccggcggcaccggcccccgcggctgctcccgccgccaaggctccgccgtccgatgcgccg
ctggcgccgtcggtgcgccggctgtcaaccgagagcggcgtcgacgcctcgaccgtgccg
ggctccggcaaggacggtcgcgtcaccaagggcgatatgctggcggcgatcgagaaggcg
gcctcggcgccgaccccggtcaatcagcccgccgccgcggtgcaggtccgcgggccgtca
ccggccgacgacgccgcacgcgaggagcgggtgaagatgacccggctgcgccagaccatc
gcgcgccgcctgaaggaagtacagaacaccgccgcgatgctgacgaccttcaacgaggtc
gacatgaccaacgtcatggcgctgcgcgcgcagtacaaggacgtgttcgagaagaaacac
ggcgccaagctcggcttcatgggcttcttcaccaaggcctgcgttcaggccctgaaggat
atcccggcggtgaacgccgagatggacggcaccgacctgatctacaagaactactaccac
atcggcgtcgccgtcggcaccgacaagggcctcgtggtcccggtggtgcgcgactgcgac
gagaagtcgatcgccgacatcgaaaagagcatcgtcgactacggcaagcgtgcccgtgac
ggtcagctcaagatcgaggagatgcagggcggtaccttcacgatcaccaacggcggaatc
tacgggtcgctgatgtcgaccccgatcctgaacgcgccgcagtccggcattctcggcatg
cacaagatccaggaacgcccggtggtgatcggcggcaagatcgaagtgcgcccgatgatg
tatttggcgctgagctatgatcaccgcgtgatcgacggcaaggaagccgtgaccttcctg
gttcgcgtcaaggagagcctggaagacccggcgcgcctggtgctggatctctga

DBGET integrated database retrieval system