KEGG   Rhodopseudomonas palustris CGA009: RPA0191Help
Entry
RPA0191           CDS       T00153                                 

Gene name
sucC
Definition
(GenBank) succinyl-coA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00020  Citrate cycle (TCA cycle)
rpa00640  Propanoate metabolism
rpa00660  C5-Branched dibasic acid metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
Module
rpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPA0191 (sucC)
   00640 Propanoate metabolism
    RPA0191 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RPA0191 (sucC)
Enzymes [BR:rpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RPA0191 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: CAE25635
CyanoBase: RPA0191
CYORF: RPA0191
UniProt: Q6NDB7
Position
complement(213515..214711)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQLGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVNRLYIEEGSDIDKEFYL
SLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPATGIMGHHGRTVAKALNLK
GEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCLDAKISFDGNALYRHTDIQ
ALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMATMDIIKLYGMSPANFLDVG
GGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAEGVVAAVKEVGLDVPLVVRLE
GTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaaggcggtgctgcgcgagttcggtgtgccggtgggg
cacggcttcccgatcttcaaggcgtccgaagcggaagccgccgccaagcagctcggcggc
ccggtctgggtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaagcttccgccggcgataagggcggcgttcgcctcgccaagtcgatcgacgaggtcaag
gaattcgccaagcagatgctcggcgccacgctggtgacggtgcagaccggcgctgacggc
aagcaggtcaaccgcctctacatcgaggaaggctccgacatcgacaaggagttctacctg
tcgctgctggtcgatcgcgccacctcgcggatttccttcgtggtctcgaccgaaggcggc
atgtcgatcgaagacgttgcccacgagacgcccgagaagatcgtgtcgttcaccgtcgat
ccggcgaccggcatcatgggccatcacggccgcaccgtcgccaaggcgctgaacctcaag
ggcgagcaggccaagcaggccgaagcgatggtggcgaagctttacaccgccttcgtcgcc
aaagacatggacatgctcgagatcaacccgctggtgctgaccaagcagggcgatctgaag
tgcctcgacgccaagatctcgttcgacggcaacgcgctgtaccgccacaccgacatccag
gccctgcgtgacgagaccgaggaagacgccaaggaaatcgaagcgtcgaaatacgacctc
aactacgtcaccctcgacggcaccatcggctgcatggtcaacggcgccggcctcgcgatg
gcgacgatggacatcatcaagctgtacggcatgagcccggccaacttcctcgacgtcggc
ggcggcgccagcaaggagaaggtgaccgcggcgttcaagatcatcactgccgatccgaac
gtgaagggcatcctgatcaacatcttcggcggcatcatgaagtgcgacgtgatcgccgaa
ggcgtggtcgcagcggtcaaggaagtcggtctcgacgtgccgctggtggttcgcctcgaa
ggcaccaatgtcgaagccggcaagaagatcatcaagcattccggcctcaacgtgctgccc
gccgacaatctcgacgacgccgcgcagaagatcgtcgccgccgtgaagggagcctga

DBGET integrated database retrieval system