KEGG   Rhodopseudomonas palustris CGA009: RPA0211Help
Entry
RPA0211           CDS       T00153                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rpa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
234927..236879
Genome map
AA seq 650 aa AA seqDB search
MSEKIYDVPAEWASRAFVDDAKYRQMYERSVTDPTGFWAEHAKRVDWIKAPTKIDNWSFA
PGNVSIKWFEDGVLNAAYNCIDRHLDKRGDQVAIIWEGDDPSQSRSITYRELHDEVCKFA
NILRNRNVGKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFAGFSPDSLAGRINDCNSK
IVITADEGLRGGRKVPLKANVDAALKKCEGVDWVMVVKRTGAAVEMDDVRDFWYHEAAEV
VTTECPVEHMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVFASMTHQYVFDYHDGDIYWC
TADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFWEVIDKHKVNIFYTAPTAIRA
LMQAGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETGGILI
TPLPGATKLKPGSATRPFFGVVPEILDPEGNVLEGECTGNLCLARSWPGQMRTVYGDHAR
FEQTYFSAYKGKYFTGDGCRRDTDGFYWITGRVDDVINVSGHRMGTAEVESSLVAHPKVS
EAAVVGYPHDIKGQGIYAYVTLMAGEEPTEELRKELVAWVRKDIGPIASPDLIQFAPGLP
KTRSGKIMRRILRKIAEDEPSSLGDTSTLADPAVVDDLVEHRQNKHHKAS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagatctacgacgtgcccgcagagtgggcgagccgcgccttcgtcgacgac
gccaaatatcgccagatgtacgagcgctcggtcacggatccgaccggattctgggcggag
cacgccaagcgcgtcgactggatcaaggcgccgaccaagatcgacaactggtcgttcgcg
cccggcaacgtttcgatcaagtggttcgaggacggcgtcctcaacgccgcctacaactgc
atcgaccgccacctcgacaagcgcggcgaccaggtcgcgatcatctgggaaggcgacgat
ccttcgcagtcgcgcagcatcacctatcgcgagctgcacgacgaggtctgcaagttcgcc
aacatcctgcgcaaccgcaatgtcggcaagggtgaccgcgtcaccatctatctgccgatg
attccggaagccgcgttcgcgatgctggcctgcgcccggatcggcgcgatccactcggtg
gtgttcgccggcttctcgcccgacagcctcgcgggccgcatcaacgactgcaactcgaag
atcgtcatcaccgccgacgaaggcctgcgcggcggccgcaaggtgccgctgaaggccaat
gtcgacgcggcgctgaagaagtgcgagggcgtcgactgggtgatggtggtcaaacgcacc
ggcgccgcggtcgaaatggatgacgtccgcgacttctggtaccacgaagccgccgaggtg
gtgacgaccgagtgcccggtcgagcacatgcatgccgaagacccgctgttcatcctctac
acctcgggctcgaccggccagccgaagggcgtgctgcataccaccggcggctatctggtg
ttcgcgtcgatgacgcaccaatacgtcttcgattatcacgacggcgacatctactggtgc
accgccgacgtcggctgggtcaccggccacagctacatcctgtacgggccgctcgccaac
ggcgccacgacgctgatgttcgaaggcgtgccgaactatccgaccaattcccggttctgg
gaagtgatcgacaagcacaaggtcaacatcttctacaccgcaccgaccgcgatccgcgcg
ctgatgcaggccggcgacgagccggtgaagaagacctcgcgcaagtcgctccgcctgctc
ggctcggtcggcgagccgatcaatccggaagcctgggagtggtaccaccgcgtcgtcggc
gaggaccgctgcccgatcgtcgacacctggtggcagacggagaccggcggcatcctgatc
accccgctgcccggcgccaccaagctgaagcccggctctgcgacccggccgttcttcggc
gtggtacccgagatcctcgatccggaaggcaacgttctggaaggcgaatgcaccggcaac
ctctgcctcgcccgctcctggccgggacaaatgcggaccgtgtacggcgaccatgcccgg
ttcgagcagacctacttctcggcctacaagggcaagtacttcaccggtgacggctgccgg
cgcgacaccgacggcttctactggatcaccggccgggtcgacgacgtcatcaacgtctcg
ggtcaccgcatgggcaccgccgaggtcgaatcctcgctggtggcgcatccgaaggtgtcc
gaggcggcggtggtcggctatccgcacgacatcaagggccagggtatctacgcctatgtg
accctgatggccggcgaagagccgaccgaggagctgcgcaaggaactggtcgcctgggtc
cgcaaggacatcggcccgatcgcctcgcccgacctgatccagttcgcgcccggcctgccc
aagacccgctccggcaagatcatgcgccgaatcctacgcaagatcgcggaggacgaaccg
tcctcgctcggcgacacctcgacgctggccgatcccgcggtggtcgacgatctggtcgag
catcgccagaacaagcaccacaaggcgagctga

DBGET integrated database retrieval system