KEGG   Rhodopseudomonas palustris CGA009: RPA0218Help
Entry
RPA0218           CDS       T00153                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b small subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00020  Citrate cycle (TCA cycle)
rpa00190  Oxidative phosphorylation
rpa00650  Butanoate metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
Module
rpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPA0218 (sdhD)
   00650 Butanoate metabolism
    RPA0218 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RPA0218 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAE25662
CyanoBase: RPA0218
CYORF: RPA0218
UniProt: Q6ND91
Position
complement(243879..244292)
Genome map
AA seq 137 aa AA seqDB search
MSSDAHGKRTPTSMRTPIGKVRKFGPAGSGTSDFWQQRITGVAMALLILPTIVVIMMLLG
RNQAAAAQILGSPLISLIMILFIIASAIHMKIGMQVVIEDYVQNEKLKLVTIMANNFFSI
AVALAAIFAIFKMASGV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgacgcccacggcaagcgcacgccgacctcgatgcgcactccgatcggcaag
gtgcgcaaattcggccccgccggctccggaacctcggatttctggcagcagcgcatcacc
ggcgtcgccatggcgctgctgatcctgccgaccatcgtggtgatcatgatgctgctcggc
cgcaaccaggcggccgccgcgcagatcctcggctctccgctgatctcgctgatcatgatc
ctgttcatcattgcctccgcgatccacatgaagatcggcatgcaggtggtgatcgaggac
tacgtccagaacgaaaagctcaagttggtcaccatcatggccaacaacttcttctcgatc
gccgtggcgctggccgcgatctttgcgatcttcaaaatggcatccggagtttaa

DBGET integrated database retrieval system