KEGG   Rhodopseudomonas palustris CGA009: RPA0374Help
Entry
RPA0374           CDS       T00153                                 

Definition
Zn-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPA0374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA0374
  Lipid metabolism
   00071 Fatty acid degradation
    RPA0374
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPA0374
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPA0374
   00626 Naphthalene degradation
    RPA0374
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPA0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(408104..409087)
Genome map
AA seq 327 aa AA seqDB search
MDAMVLTAPGTSLQWQSRDTPQPGDGEVLVTVSACGVCRTDLHVVDGELPNIRYPIIPGH
EIVGRVAAVGAGVTTHQIGDRVGIPWLGHTCGLCRYCRGGMENLCDAPLFTGYTRDGGFA
SHAIADARYAFPLGEAGDDVAIAPLLCAGLIGWRSLAIAGDAERLGIYGFGAAGHIVAQV
ARWQGRQVYAFTRGGDVAAQDFARSLGAVWAGASEEQPPQPLDAAIIYAPVGSLVPAALK
AVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQDGVDFLEVAQQASIRTETH
AFPLREANTVLNKLRAGELLGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatggtgctgacggcaccgggcacgtcgctgcaatggcaatcgcgcgacacg
ccgcagccgggtgacggcgaggtgctggtcacggtgagcgcttgcggcgtctgccgcact
gaccttcacgtcgtcgatggcgaattgccgaacatccgttatccgatcattcccggccat
gagatcgtcggccgcgtcgcggcggtcggcgctggcgtcaccacacatcagatcggtgac
cgcgtcggcattccctggctcggccacacttgcgggctgtgccgctactgccgaggcggc
atggagaatctgtgcgatgcgccgctgttcaccggctacacccgcgacggcggatttgcg
tctcacgccatcgccgacgcgcgctatgcgtttccgctcggcgaggccggcgatgacgtt
gcgattgcgccgctgctgtgcgccggactgatcggctggcgttcgctggcgatcgccgga
gacgcagagcggcttggcatctacggcttcggcgccgccggccacatcgtggcgcaggtc
gcgcgctggcaagggcggcaggtatatgccttcacccgcggcggcgatgtcgcggctcag
gacttcgcccgcagcctcggcgcagtgtgggccggcgcttccgaggagcaaccgccgcag
ccgctcgacgccgcgatcatctacgcgccggtcggcagcctggtgccggccgcgctgaag
gcggtgcgcaaaggcggccgcgtggtctgcgccggcatccatatgagcgacatcccgagc
tttccgtacgatctgctgtgggaggaacgccagctcgtttcggtcgccaacctcacccga
caggacggtgtcgattttcttgaggtggcgcagcaggccagcattcgaaccgagacccat
gcctttccgctacgtgaggccaacacggttttgaacaaactccgcgcgggcgaactgctc
ggtgcggcggtgctggtgccatag

  All links  
No link information was found.   
DBGET integrated database retrieval system