KEGG   Rhodopseudomonas palustris CGA009: RPA0374Help
Entry
RPA0374           CDS       T00153                                 

Definition
Zn-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rpa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rpa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rpa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rpa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:rpa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(408104..409087)
Genome map
AA seq 327 aa AA seqDB search
MDAMVLTAPGTSLQWQSRDTPQPGDGEVLVTVSACGVCRTDLHVVDGELPNIRYPIIPGH
EIVGRVAAVGAGVTTHQIGDRVGIPWLGHTCGLCRYCRGGMENLCDAPLFTGYTRDGGFA
SHAIADARYAFPLGEAGDDVAIAPLLCAGLIGWRSLAIAGDAERLGIYGFGAAGHIVAQV
ARWQGRQVYAFTRGGDVAAQDFARSLGAVWAGASEEQPPQPLDAAIIYAPVGSLVPAALK
AVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQDGVDFLEVAQQASIRTETH
AFPLREANTVLNKLRAGELLGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatggtgctgacggcaccgggcacgtcgctgcaatggcaatcgcgcgacacg
ccgcagccgggtgacggcgaggtgctggtcacggtgagcgcttgcggcgtctgccgcact
gaccttcacgtcgtcgatggcgaattgccgaacatccgttatccgatcattcccggccat
gagatcgtcggccgcgtcgcggcggtcggcgctggcgtcaccacacatcagatcggtgac
cgcgtcggcattccctggctcggccacacttgcgggctgtgccgctactgccgaggcggc
atggagaatctgtgcgatgcgccgctgttcaccggctacacccgcgacggcggatttgcg
tctcacgccatcgccgacgcgcgctatgcgtttccgctcggcgaggccggcgatgacgtt
gcgattgcgccgctgctgtgcgccggactgatcggctggcgttcgctggcgatcgccgga
gacgcagagcggcttggcatctacggcttcggcgccgccggccacatcgtggcgcaggtc
gcgcgctggcaagggcggcaggtatatgccttcacccgcggcggcgatgtcgcggctcag
gacttcgcccgcagcctcggcgcagtgtgggccggcgcttccgaggagcaaccgccgcag
ccgctcgacgccgcgatcatctacgcgccggtcggcagcctggtgccggccgcgctgaag
gcggtgcgcaaaggcggccgcgtggtctgcgccggcatccatatgagcgacatcccgagc
tttccgtacgatctgctgtgggaggaacgccagctcgtttcggtcgccaacctcacccga
caggacggtgtcgattttcttgaggtggcgcagcaggccagcattcgaaccgagacccat
gcctttccgctacgtgaggccaacacggttttgaacaaactccgcgcgggcgaactgctc
ggtgcggcggtgctggtgccatag

DBGET integrated database retrieval system