KEGG   Rhodopseudomonas palustris CGA009: RPA0376Help
Entry
RPA0376           CDS       T00153                                 

Gene name
pimt1
Definition
L-isoaspartyl protein carboxyl methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpa  Rhodopseudomonas palustris CGA009
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
409612..410334
Genome map
AA seq 240 aa AA seqDB search
MTSPASDLPPLSGRSFAVLRELMVERQIAARGVHDPRVLAAMRKVPREAFLPEPMRDLAY
EDAPVPIAAEQTMSQPYIVALMVEALLLQGSDNVLEIGAGSGYAAAVLGEIAGHVTTVER
IATLADAAAAKLAELGYGDVDVHRSDGTRGWPAAAPYDAIVVAAGGPQVPESLKAQLKIG
GRLVMPVGADQQAQELVRLTRLGEADFKREHLGDVRFVPLLGAEGWQQPEPAGRTAREKG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctccagcttcggacttgccgccgctcagcggtcgttcgttcgcggtgctgcgc
gaactgatggtcgagcgccagatcgcagcgcgcggcgtgcatgatccgcgcgtgcttgcc
gcgatgcgcaaggtgccgcgcgaagccttcctgccggaaccgatgcgtgatctggcgtac
gaagacgcgccggtgccgatcgccgccgagcagacgatgtcgcagccctacatcgtggcg
ctgatggtcgaggcgctgttactgcagggcagcgacaacgtgctcgaaatcggcgccggc
tccggctacgccgccgcggtgctcggcgagatcgccggtcatgtcaccacggtggagcgc
atcgctacgctggcggacgctgcggcggcgaagctcgccgagctcggttacggcgatgtc
gacgtgcatcggagcgatggcacccgcggttggcccgcagcggcgccttacgacgcgatc
gtggtcgccgccggcgggccgcaggtgccggagtcgctgaaggcccagctcaagatcggc
ggacggctggtgatgccggtcggagccgatcagcaagcccaggaactggtgcgcctgaca
cggctcggcgaggccgatttcaagcgcgagcacctcggtgatgttcgcttcgtgccgctg
ctcggcgctgaggggtggcagcagccagagccggccggcaggacggcccgcgaaaagggg
tga

DBGET integrated database retrieval system