KEGG   Rhodopseudomonas palustris CGA009: RPA0379Help
Entry
RPA0379           CDS       T00153                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPA0379 (pfkB)
   01230 Biosynthesis of amino acids
    RPA0379 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA0379 (pfkB)
   00030 Pentose phosphate pathway
    RPA0379 (pfkB)
   00051 Fructose and mannose metabolism
    RPA0379 (pfkB)
   00052 Galactose metabolism
    RPA0379 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    RPA0379 (pfkB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RPA0379 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
413011..413949
Genome map
AA seq 312 aa AA seqDB search
MVDIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVARVVQRLGGNVEAIFP
AGGFTGKLLKLLLDEENVPNRIVEAVAETREDFSVSENATGEQFRFVLPGLPLAEHEWRG
MLETLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQLGAKFFLDTSGKPLTAALAQG
VTLIKPNLREMQELAGRPLGCEKEWVDAARAHITAGQVEIVALSLGHLGALLVTKDEALR
SPALPVTPVSTVGAGDSFLAAIAHRLAQGGSVADAFRLGLAAGSATLTVHGTQLCGPAEV
ERLYGQVIIEPI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatcgtcacccttacgcccaatcctgcgatcgacctgtcgacgtcggtcgag
cgtttggtgccgagccgcaagctgcgctgcgcggcgcagaagcgcgaccccggcggtggt
ggtatcaacgtggcgcgtgtggtgcagcggctcgggggaaacgtcgaggcgatctttccg
gccggcggcttcaccggcaagctgctcaagctgctgctcgacgaggagaacgtcccaaac
cgcatcgtcgaagcggtcgcggagacccgcgaggacttctcggtcagcgagaatgccacc
ggcgaacaattccgcttcgtgctgcccggcctgccgctggccgagcacgaatggcgcggc
atgctggagactctggcggcgacctcgccggcgccgaagatcgtgatcggcagcggtagc
ctgccgccgggcgtgccggtcgatttttacgcgcaggccgccgcggtggcgaaacagctc
ggcgcgaagttcttcctcgatacctccggcaagccgctgaccgcggcgctggcgcagggc
gtcacgctgatcaagccgaacctgcgcgagatgcaggagctcgccggccgcccgctcggc
tgcgagaaggaatgggtcgacgctgcgcgcgcgcatatcacggccggtcaggtcgagatc
gtggcgctgtccctcggccatctcggtgcgctgctggtcaccaaggacgaggcgctgcgg
tcgccggcgttgccggtgaccccggtgtcgacggtcggtgccggtgacagcttcctggcc
gccatcgcgcatcgcctggcgcagggcggttcggtcgccgatgctttccggctcggtctt
gcggccggctcggcgactctcaccgtgcacggcacgcagctgtgcgggccggccgaggtc
gaacggctgtacggtcaggtgatcatcgagccgatctga

DBGET integrated database retrieval system