KEGG   Rhodopseudomonas palustris CGA009: RPA0383Help
Entry
RPA0383           CDS       T00153                                 

Definition
(GenBank) probable enoyl CoA-hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00071  Fatty acid degradation
rpa00280  Valine, leucine and isoleucine degradation
rpa00281  Geraniol degradation
rpa00310  Lysine degradation
rpa00360  Phenylalanine metabolism
rpa00362  Benzoate degradation
rpa00380  Tryptophan metabolism
rpa00410  beta-Alanine metabolism
rpa00627  Aminobenzoate degradation
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa00903  Limonene and pinene degradation
rpa00930  Caprolactam degradation
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPA0383
   00650 Butanoate metabolism
    RPA0383
  Lipid metabolism
   00071 Fatty acid degradation
    RPA0383
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPA0383
   00310 Lysine degradation
    RPA0383
   00360 Phenylalanine metabolism
    RPA0383
   00380 Tryptophan metabolism
    RPA0383
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPA0383
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPA0383
   00281 Geraniol degradation
    RPA0383
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA0383
   00627 Aminobenzoate degradation
    RPA0383
   00930 Caprolactam degradation
    RPA0383
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPA0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAE25827
CyanoBase: RPA0383
CYORF: RPA0383
UniProt: Q6NCT6
Position
419505..420305
Genome map
AA seq 266 aa AA seqDB search
MPGQDTVLIERDGPVTIVTINRPERRNAVDGATAKKLYDAFLAFDADESASVAVFTGAGG
TFCAGADLKAVAAGDAEKKREIAGHNTLAPMGPSRLRLSKPVIAAVEGFAVAGGLELALW
ADMRVVAEDATFGVFCRRFGVPLIDLGTIRLPRLIGHSQAMDLILTGRPVAADEAHRIGL
ANRLVPRGEALPRAIELAKQISQFPQTCLRADRLSAFQQWDLPEEDAIMNEMRGGLKVIQ
SGETLSGATRFAQGEGRHGAFGKPAP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccaggataccgtgctgatcgagcgcgacggtccggtgaccatcgtcacgatt
aatcgccccgagcgccgcaacgccgtcgatggcgcgaccgccaaaaaactgtacgacgcc
ttcctggcgttcgatgccgacgagtccgcttccgttgcggtgttcaccggcgcgggcggc
acgttctgcgccggggccgatctgaaagcggtagcggcgggcgatgccgaaaagaagcgc
gaaatcgccggccacaatacgctggcgccgatggggccgagccgtctgcggctgtccaag
ccggtgatcgcggcggtcgagggctttgcggtcgccggcgggctcgaactggcgctgtgg
gccgatatgcgcgtggtcgccgaagacgcgacgttcggggtgttctgccgccgtttcggc
gtgccgctgatcgatctcggcaccatccggttgccgcggctgatcggccattcgcaggcg
atggatctgatcctcaccggccggccagtggcggccgacgaggcgcaccgcatcggcctc
gccaaccgcctggtgccgcgcggtgaagcgctgccgagggcgatcgaactcgccaagcag
atctcgcaatttccgcaaacctgcctgcgcgccgaccggctgtccgccttccagcaatgg
gatctgcccgaggaagacgctatcatgaacgagatgcgcggcgggctgaaggtcatccag
tccggcgagaccctgtccggagcgacccgcttcgcccagggcgaagggcggcatggggcg
ttcggcaagccggctccatga

DBGET integrated database retrieval system