KEGG   Rhodopseudomonas palustris CGA009: RPA0391Help
Entry
RPA0391           CDS       T00153                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rpa00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpa00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rpa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(429741..431498)
Genome map
AA seq 585 aa AA seqDB search
MMTKHIAATAFASLMFVSAASAQTIYPIDRAEILAGAKFDLKVEFAGEVAANTASLTING
ADAASVFGKAPELIAQEAGQPRSALLLRDVTLNKPGRYSIEAGDGATRRSVSWTVYDTGP
RRAKNVILFIGDGLSPAHRVAARLLSKGIQEGRAGGKLAIDDMPQMALVSTAGSDSIITD
SANAASAYATGHKAAVNAMGVYADRTPDPLDDPKVETLASVAKRRLGLSIGIVTNTEVED
ATPAAVIAHTRRRAAYDDIVAQFYAAQPDVLMGGGAAYFLPKSANGKRKDDIDYLAKFRD
AGYAVANNATDLDAASKTAPRKLLGLFAPGNMDGVLDRRFLKGGGVTKNPDQPDLTQQVA
VALDVLSKNDAGFFLMVESGLIDKYAHALDMERAVYDTIMLDNAVRQTRDWAKARGDDTL
ILVVADHNHPNALVGTVRDDLAEGDDVPLRERIGVYERAGFPNYPAPDADGYPERVDVSR
RIAIFSASLPDHYETLRPKLDGPNQPTEAGDKPGTFKANDKYKGVPGAVLRIGNLPAMMN
ASVHSGEDVILTATGPGSDRVRGSLENTDVFRVMAAALGLGAEAK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaagcatattgccgcgaccgcgtttgcgtcgctgatgttcgtttcggccgct
tcggcccagacgatttatccaatcgaccgcgccgagattctggccggcgccaagttcgac
ctcaaggtcgaattcgcgggcgaagtcgcggccaacacagcgagcctcaccatcaatggc
gctgacgccgcgagcgtgttcggcaaggcaccggagctgatcgcgcaagaagcggggcag
ccgcgatcggcgctgctgctccgcgacgtaacgctgaacaaacccggccgctacagcatc
gaagccggtgacggcgctacacgccgcagcgtgagctggacggtgtacgacaccgggcca
cgccgggccaagaacgtgatcctgtttatcggcgacggactgtcgccggcgcatcgggtg
gcggcacgactgctgtcgaaaggcattcaggaaggccgtgcgggcggcaagctggcgatc
gacgacatgccgcagatggcgctggtctcgaccgcgggcagcgactcgatcatcaccgac
tcggccaatgcggccagcgcctacgcgaccggccataaggccgccgtcaacgcgatgggg
gtctatgcggaccgcacccccgacccgctcgacgaccccaaggtggaaacgcttgcgtcg
gtcgcgaagcgacggctggggctgtcgatcggcatcgtcaccaacaccgaagtggaagac
gcgacgcccgccgcggtgatcgcccacacccgccgccgcgcggcttatgacgacatcgtc
gcgcagttctatgccgcgcagcccgacgtgctgatgggcggcggcgccgcttacttcctg
ccaaagagcgcgaacggcaagcgcaaggatgatatcgattatctggcgaagttccgcgac
gccggctacgcggtcgccaacaatgcgaccgacctcgacgcggcgagcaagaccgccccg
cgaaaactgctcggcctgttcgctcccggcaacatggacggcgtgctcgaccgccgtttc
ctgaaaggtggtggcgtcaccaagaaccccgaccagcctgatctgacccagcaggtcgcg
gtcgcgctcgacgtgctgtcgaagaacgatgcgggcttcttcctgatggtcgaatccggc
ctgatcgacaaatacgcccatgcgctcgacatggagcgagccgtctatgacaccatcatg
ctcgacaacgcggtgcgccagacccgcgactgggccaaggcccgcggcgacgacacgctg
atcctggtggtggccgatcacaaccatccgaacgcgctggtcggcaccgtgcgcgacgat
ctcgccgagggtgacgacgtgccgctgcgcgagcggatcggcgtgtacgaacgcgccggc
tttccgaactatccggcgcccgatgcggacggctatccggagcgggtcgatgtcagccgg
cgcatcgcgatcttctcggccagccttccggatcactacgagacgctgcggccgaagctc
gacgggccgaaccagccgaccgaggcgggcgacaagcccggcaccttcaaggccaacgac
aagtacaagggcgtgcccggcgcggtgctgcgcatcggcaatctgccggcgatgatgaat
gccagcgtgcactccggcgaggacgtgatcctgaccgctaccggccccggcagcgaccgc
gttcgcggctcgctggagaacaccgacgtgttccgggtgatggccgccgcgctgggcctc
ggcgccgaggccaagtag

DBGET integrated database retrieval system