KEGG   Rhodopseudomonas palustris CGA009: RPA0560Help
Entry
RPA0560           CDS       T00153                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPA0560 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPA0560 (MLYCD)
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     RPA0560 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(621701..623131)
Genome map
AA seq 476 aa AA seqDB search
MKLMPIATTADRASEFLGGLFNSLTERGRSLFGLTSSQPMSGDELIALSETLLSRRGEAS
GVALAASLLAGYEAADEDDKLAFLDALAEQFGPDLAELNTAIEAFRADASAEATGELLRA
AEPRRQELIRRLNHAPGGTAALVKMREAVLARIAAHPQLRHVDDDFVHLFTSWFNRGFLV
LQRIDWTTPANILEKIIRYEQVHTIHDWDDLRARLAPPDRRCYGFFHPRLVDEPLIFVEV
ALTKDSPAAIAPLLDLEREPIAASDATTAVFYSISNTQQGLAGISFGNFLIKQVVEEIKR
ELPNVQTFVTLSPVPGFAKWLKRERDNPDSTLLDASARTALEALDTPNWFDDADTADRLK
PIVLQLAAAYFLQAKGPNGRPLDPVARFHLGNGARLDRLNFLGDRSPNGMRQSHGLMVNY
LYALGDIEANHEALFERGQIAAASAVRKLVPTKPVTSEPRKGNGKTASAPQAAPTA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatgccgatagccaccactgcagaccgcgcttcggaatttctcggcggcttg
ttcaacagcctcaccgaacgcggccgcagcctgttcgggctgaccagctcacagccgatg
tccggggacgaactgatcgcgcttagtgagacgctgctgtcgcggcggggtgaagcgtcc
ggcgtcgcgctggccgcatcgctgctcgccggctacgaggctgccgacgaagacgacaag
ctggcgtttctcgatgcgctcgccgaacagttcgggcccgacctcgccgaactcaacacc
gcgatcgaggcgtttcgcgccgacgcctcggccgaggcgaccggtgaattgctacgcgcc
gccgagccgcgccggcaggagctgatccgccgcctcaatcacgctccgggcggcaccgcg
gcgctggtgaagatgcgcgaggcggtgctcgcccgcatcgctgcgcatccgcagcttcgt
cacgtcgacgacgatttcgtgcatctgttcacgtcgtggttcaatcggggatttctcgtg
ctgcagcggatcgactggacgacgccggccaacatcctggaaaagatcatccgctacgag
caggtacacaccatccacgactgggacgatctgcgcgcgcggctggccccgccggaccgg
cgttgctacggcttcttccatccgcggctggtcgacgagccgttgatcttcgtcgaggtc
gcgctgaccaaggacagccctgccgcgatcgcaccgctgctcgatctcgagcgcgagccg
atcgccgccagcgatgcaacgactgcagtgttctattcgatctccaacacccagcagggc
ctcgccgggatctcgttcggcaatttcctgatcaagcaggtggtggaggagatcaagcgc
gagctgccgaacgtgcaaaccttcgtgacgctgtcgccggtgccgggcttcgccaagtgg
ctgaagcgcgaacgcgacaatccggattcgacgctgctcgatgcctccgcgcgcaccgcg
ctcgaagcgctcgatacgccgaactggttcgacgatgccgacaccgccgaccggctgaag
ccgatcgtgctgcagctcgccgccgcttacttcctgcaggccaaggggccgaacggccgg
ccgcttgatccggtggcccgcttccacctcggcaacggcgcgcggctcgaccggctgaac
ttcctcggcgaccgttcgccgaacggcatgcgccagtcgcacgggctgatggtcaactac
ctgtatgcgctcggcgacatcgaggccaaccacgaggcgctgttcgaacgcggccagatc
gccgccgcctccgcagtgcgcaagctggtgccgaccaagccggtgaccagcgaaccgcgc
aagggcaacggaaagactgcgagcgccccgcaggccgcgccgacggcgtga

DBGET integrated database retrieval system