KEGG   Rhodopseudomonas palustris CGA009: RPA0617Help
Entry
RPA0617           CDS       T00153                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
684958..685560
Genome map
AA seq 200 aa AA seqDB search
MAGAAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMAPLASALQVAIDKIEVCS
TCGNIDSQNPCTVCTDPRRDSSIIVVVADVADLWALERASATNGRYHVLGATLSPLDGVG
PEDLTIDALVKRAHDPGVAEIILALNATVDGQTTAHYVTDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgccgcaggccccgagatcgaacgtttgattcaattgctggcgcggctgccc
ggattggggccacgctcggcgcgtcgcgccgcgctgcatttgatcaagaagcgcgacgcg
ctgatggcgcctctcgcctccgccctgcaggttgcgatcgacaagatcgaagtgtgcagc
acatgcggcaacatcgattcacaaaacccgtgcacggtgtgcaccgatccgcgacgggat
tcctcgatcatcgttgtggtggctgacgttgcggatttgtgggcactcgaacgcgcctct
gccacaaacggccggtaccacgttctgggagcgacgctctcgccgctcgacggcgtcggc
cccgaagatctgacgatcgacgcgttggtgaagcgtgcacatgaccccggcgttgccgag
atcatcctggcgctcaacgccaccgtcgatggccagaccaccgcacattacgtcaccgac
ctcttgcaggacgccaacgtcaaggtgacccggctcgctcacggcgtgccggtcggtggc
gaactcgactatcttgacgaaggtacgctgtcggcggcgatgcgacagcgcaccttgttc
tga

DBGET integrated database retrieval system