KEGG   Rhodopseudomonas palustris CGA009: RPA0617Help
Entry
RPA0617           CDS       T00153                                 

Gene name
recR
Definition
(GenBank) putative recombination protein recR
  KO
K06187  recombination protein RecR
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPA0617 (recR)
DNA repair and recombination proteins [BR:rpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     RPA0617 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RPA0617 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5
Motif
Other DBs
NCBI-ProteinID: CAE26061
CyanoBase: RPA0617
CYORF: RPA0617
UniProt: Q6NC55
Position
684958..685560
Genome map
AA seq 200 aa AA seqDB search
MAGAAGPEIERLIQLLARLPGLGPRSARRAALHLIKKRDALMAPLASALQVAIDKIEVCS
TCGNIDSQNPCTVCTDPRRDSSIIVVVADVADLWALERASATNGRYHVLGATLSPLDGVG
PEDLTIDALVKRAHDPGVAEIILALNATVDGQTTAHYVTDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgccgcaggccccgagatcgaacgtttgattcaattgctggcgcggctgccc
ggattggggccacgctcggcgcgtcgcgccgcgctgcatttgatcaagaagcgcgacgcg
ctgatggcgcctctcgcctccgccctgcaggttgcgatcgacaagatcgaagtgtgcagc
acatgcggcaacatcgattcacaaaacccgtgcacggtgtgcaccgatccgcgacgggat
tcctcgatcatcgttgtggtggctgacgttgcggatttgtgggcactcgaacgcgcctct
gccacaaacggccggtaccacgttctgggagcgacgctctcgccgctcgacggcgtcggc
cccgaagatctgacgatcgacgcgttggtgaagcgtgcacatgaccccggcgttgccgag
atcatcctggcgctcaacgccaccgtcgatggccagaccaccgcacattacgtcaccgac
ctcttgcaggacgccaacgtcaaggtgacccggctcgctcacggcgtgccggtcggtggc
gaactcgactatcttgacgaaggtacgctgtcggcggcgatgcgacagcgcaccttgttc
tga

DBGET integrated database retrieval system