KEGG   Rhodopseudomonas palustris CGA009: RPA0624Help
Entry
RPA0624           CDS       T00153                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rpa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rpa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(691642..692805)
Genome map
AA seq 387 aa AA seqDB search
MTSTPTALSIAQDLLRCPSVTPADAGALDVLETLLKGAGFTVHRVTFSEPGTADIDNLYA
RIGNTSPHLCFAGHTDVVPPGDASAWTHGAFAGDVADGLLYGRGAVDMKGGIACAVAATL
DYLAANGGQPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEQFDHCIVGEPSNVETIGD
TIKIGRRGSQSGVLIVDGVQGHVAYPHRAANPVPDIAKLITALNDEPLDHGSAQFQPSNL
EFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQETLKALVEHRLVAACGNRIRAHIEWLP
SNADVFVTKPGAFTDLVGAAIAEVTRRTPELNTGGGTSDARFIAKYCQVVEFGLVGQTMH
QIDERTPVSDLDKLTAIYRGVLERYFK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgactccgactgcgctttcgatcgcccaagacctgctgcgctgcccgtctgtg
actccggcggacgccggcgcactcgacgtgctggagacgctgctcaaaggggcgggcttc
acggtgcatcgcgtcaccttctcggagccgggcaccgccgacatcgacaacctgtatgcg
cggatcggcaacacctcgccgcatctttgcttcgccggccacaccgacgtggtgccgccg
ggcgatgccagtgcctggacccacggcgcgttcgccggcgacgttgcggacggcctgctg
tacggtcgcggtgcggtcgacatgaaaggtggtatcgcctgcgcggtcgcggcaacgctg
gactacctcgcggcgaacggcggccagcccaagggctcgatctcgttcctcatcaccggc
gacgaggaagatgtcgcggtcaacggcaccgtcaagctgctgcaatgggccgccgagcgc
ggcgagcaattcgatcactgcatcgtcggtgagccgagcaatgtcgagacgatcggcgac
accatcaagatcggccgccgcggctcacaatctggcgtgctgatcgtcgacggtgtgcag
ggccacgtcgcctatccgcaccgcgccgccaatccggtgccggatatcgccaagctgatc
accgcgctgaacgacgagccgctcgatcacggctcggcgcaattccagccgtccaacctg
gaattcacctcggtcgatgtcggcaatccggccaccaacgtgattccggcgcaagcgcgc
gccaagttcaacatccgcttcaacgatcaccacactcaggaaacgctgaaggcactggtc
gaacatcggctggtcgcggcgtgcggcaaccgcatccgcgcccacatcgaatggctgccg
tcaaacgccgatgtgttcgtcaccaagcccggcgccttcaccgatctggtcggcgccgcg
atcgccgaggtcacccgacgcacgcccgagctcaacaccggcggcggcacatccgacgct
cgcttcatcgcgaaatattgccaggtggtcgaattcggcttggtcggccagaccatgcac
cagatcgacgaacgcacgccggtcagcgacctcgacaagctcaccgcgatctatcgcggc
gtcctggagagatacttcaagtaa

DBGET integrated database retrieval system