KEGG   Rhodopseudomonas palustris CGA009: RPA0650Help
Entry
RPA0650           CDS       T00153                                 

Gene name
badK
Definition
(GenBank) cyclohex-1-ene-1-carboxyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00071  Fatty acid degradation
rpa00280  Valine, leucine and isoleucine degradation
rpa00281  Geraniol degradation
rpa00310  Lysine degradation
rpa00360  Phenylalanine metabolism
rpa00362  Benzoate degradation
rpa00380  Tryptophan metabolism
rpa00410  beta-Alanine metabolism
rpa00627  Aminobenzoate degradation
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa00903  Limonene and pinene degradation
rpa00930  Caprolactam degradation
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPA0650 (badK)
   00650 Butanoate metabolism
    RPA0650 (badK)
  Lipid metabolism
   00071 Fatty acid degradation
    RPA0650 (badK)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPA0650 (badK)
   00310 Lysine degradation
    RPA0650 (badK)
   00360 Phenylalanine metabolism
    RPA0650 (badK)
   00380 Tryptophan metabolism
    RPA0650 (badK)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPA0650 (badK)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPA0650 (badK)
   00281 Geraniol degradation
    RPA0650 (badK)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA0650 (badK)
   00627 Aminobenzoate degradation
    RPA0650 (badK)
   00930 Caprolactam degradation
    RPA0650 (badK)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPA0650 (badK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAE26094
CyanoBase: RPA0650
CYORF: RPA0650
UniProt: G3XCR2
Position
complement(717848..718624)
Genome map
AA seq 258 aa AA seqDB search
MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA
FAAGADIASMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIV
IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV
VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADA
REGIQAFLEKRAPCFSHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgtccaatcctatcctcaccgaaacccagggccgggtcggcatcatcacgctgaac
cggccggatgtgctcaacgcgctcaacgatgccctgatggatgcgctcggcggcgcgctg
ctggcgttcgacgccgacgacggcatcggcgcgatcgtgatcgccggcaatacccgggcc
ttcgcggccggcgccgacatcgcctcgatggcagcatggagctatagcgacgtctatggc
tcgaacttcatcacccgcaattgggaaacgatccgccaaatacggaagccggtgctggcc
gcggttgccggcctcgcctatggcggcggctgcgagctggcactcgcctgcgacatcgtg
atcgctggccgcagcgccaagttcgcgctgccggaaatcaagctcggcctgctgcccggc
gccggcggcacgcaacgattgccgcgcgcgatcggtaaggccaaggcgatggacatgtgc
ctgtcggcgcggccgctcaacgccgaagaggccgatcgctatggtctggtctcccgcgtc
gtcgatgacgacaggctgcgtgacgagaccgtcgcgctggccaccacgatcgcggcgttc
tccgctccggcgctgatggcgctgaaggaaagcctcaatcgcgccttcgaaagcacgctc
gccgaaggcatcctgttcgaacgccgcgaactgcatgcccgcttcgccagtgccgacgcc
cgcgagggcattcaggcgttcctggagaagcgcgcaccgtgcttctcccaccgctag

DBGET integrated database retrieval system