KEGG   Rhodopseudomonas palustris CGA009: RPA0839Help
Entry
RPA0839           CDS       T00153                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPA0839 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA0839 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPA0839 (thrC)
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPA0839 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
933124..934554
Genome map
AA seq 476 aa AA seqDB search
MEAPLTTYVSTRGDAPRLGFCDVMLTGLARDGGLYIPEVWPQLTPDTITSLFGRPYWEVA
VEVIRPFVAGEISDAELGRMASDAYATFRHPAVVPLRQTGSSQFVLELFHGPTLAFKDVA
MQLLSRLMDHVLEKRKQRTTIVVATSGDTGGAAVEAFANLNNVDLVVLFPHGRISDVQRM
MMTTSGAPNVHPLAIEGHFDDCQAIVKGLFNHHKFRDQVALSGVNSINWARIVAQVVYYF
TSAVALGAPNRVVDFTVPTGNFGDIFAGYVAKKMGLPVRRLKIAANVNDILARTLKTGIY
EVREVHATTSPSMDIQVSSNFERLLFEASGRDASLIRSLMGSLAQSGRFVLPDAVLAAVR
EEFDAGRADEAETESAIRAAWREAGDLIDPHTAVALAVADRDTTDSSVPNIVLSTAHAAK
FPDAVEAACGIRPELPAWLDGLMSKTESIKIMPRDQVAIERHVLAVSRAAKQGAAG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcacccttgacgacctatgtttcgacccggggcgatgccccgcgcctcggcttt
tgcgacgtgatgctgaccgggctcgcccgtgacggcggactgtatattcccgaagtctgg
ccgcagctcactcccgacaccatcaccagcctgttcggccggccgtattgggaggtcgcc
gtcgaggtgatccggccgttcgtggccggcgagatttccgatgccgagcttggccgcatg
gcgagcgacgcctatgccactttccgacacccggcggtggtgccgctgcgccagaccggc
tcgagccagttcgtgctcgagctgttccatggcccgacgctggcgttcaaggacgtcgcg
atgcagctgctgtcgcggctgatggatcacgtgctggagaagcgcaagcagcgcaccacg
atcgtggtggcgacttccggcgacaccggcggcgccgcggtcgaagccttcgccaacctg
aacaatgtcgacctcgtcgtgctgtttccgcacggccggatctccgacgtgcagcggatg
atgatgaccacgtcgggcgctccgaacgtgcatccgctggcgatcgagggccacttcgac
gactgccaggcgatcgtgaaggggctgttcaatcatcataagttccgcgaccaggtggcg
ctgtccggcgtcaactcgatcaactgggcgcggatcgtggcgcaggtggtgtattacttc
accagcgcggtcgcgctcggcgcgccgaatcgcgtggtcgatttcaccgtgccgaccggc
aatttcggcgacatcttcgccggttacgtcgccaagaagatgggcctgccggtgcgccgg
ctgaagatcgccgccaacgtcaacgacatcctggcgcgtacgctgaagaccggcatttac
gaagtgcgcgaggttcacgccaccacctcgccgtcgatggacatccaggtgtcgtcgaat
ttcgagcgactgctgttcgaggcctccggacgcgatgcctcgctgatccggtcgctgatg
ggctcgctggctcagtccggccgcttcgtgctgccggatgcggtgctcgccgcggtgcgc
gaggagttcgacgccggccgcgccgacgaggcggaaaccgaatcggcgatccgtgccgcc
tggcgcgaggccggcgatctgatcgatccgcacactgcggtggcgctggcagtggccgat
cgcgacaccacagattcgagcgtgccgaacatcgtgctgtcgaccgcccatgcggcgaag
ttcccggatgctgtggaagctgcttgcggtatccggccggagctgccggcctggctcgat
gggctgatgagcaaaaccgaatcgatcaagatcatgccgcgcgatcaggtggcgatcgaa
cgtcacgtgctggcggtgagccgcgccgccaagcaaggagccgccggatga

DBGET integrated database retrieval system