KEGG   Rhodopseudomonas palustris CGA009: RPA0865Help
Entry
RPA0865           CDS       T00153                                 

Definition
homospermidine synthase
Orthology
K00808  
homospermidine synthase [EC:2.5.1.44]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Biosynthesis of secondary metabolites
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(961340..962770)
Genome map
AA seq 476 aa AA seqDB search
MSSTSKIHAKITGPIVMIGFGSIGKGALPLIERHFEYDKKRFVIIDPHEDGELAKKHGVR
FIKQAVTKDNYRELLVPLLTEGGGQGFCVNLSVDTGSVDLMTMCREIGALYIDTVVEPWL
GFYFDKNAGPEKRSNYALRETLLAAKAKNPGGTTAVSTCGANPGMVSWFVKQALLDIARD
TGLEFNEPKSREGWGQLAQKLGVKGIHIAERDTQRAKTPKPMNVFVNTWSVEGFVSEGLQ
PAELGWGTHEKWIPDNGRKHTEGCQAAIYLLQPGANTRVRTWCPTPGPQYGFLVTHNESI
SIADYFTVRDGQNVVYRPTCHYAYHPANDAVLSLHEMFGAEGKMQPKWHILDENEIVDGI
DELGVLVYGHAKNAYWYGSQLSIEETREICPYQNATGMQVSSAVLAGMVWALENPEAGIV
EADEMDFRRCLEVQKPYLGPVKGYYTDWTPLTDRPGLFPEDIDSSDPWQFKNVLVR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctacctcgaagatccatgccaagatcaccggccccatcgtgatgatcggcttc
ggctcgatcggtaagggcgcgctgcccctgatcgagcgtcacttcgagtacgacaagaag
cggttcgtcatcatcgatccgcacgaggatggcgaactcgccaagaagcacggcgtccgc
ttcatcaagcaggcggtgaccaaggacaactaccgcgagctgctggtcccgctgctgacc
gaaggcggcggccagggcttctgcgtcaacctgtcggtcgacaccggctcggtcgacctc
atgacgatgtgccgcgagatcggtgctctgtatatcgacaccgtcgtcgagccttggctc
ggcttctacttcgacaagaacgccggcccggagaagcgctccaactacgcgctgcgcgag
accctgctggccgccaaggccaagaacccgggcggcaccaccgcggtgtcgacctgtggt
gccaatcccggcatggtgtcgtggttcgtcaagcaggcgctgctcgacatcgcccgcgat
accggcctcgaattcaacgaaccgaagagccgcgaaggctggggccagctcgcgcagaag
ctcggcgtcaagggcatccacattgccgagcgtgatactcagcgcgccaagaccccgaag
ccgatgaacgtgttcgtcaacacctggtcggtggaaggcttcgtgtccgaaggcctgcag
ccggccgaactcggctggggcacgcacgagaagtggatcccggacaacggccgcaagcac
accgaaggctgccaggccgcgatctatctgctgcagcccggcgccaacactcgcgtccgc
acctggtgtccgactccgggtccgcagtacggcttcttggtaactcacaacgagtcgatc
tcgatcgccgattacttcacggtgcgtgacggccagaacgtggtgtaccggccgacctgc
cactacgcctatcacccggccaacgacgcggtgctgtcgctgcacgaaatgttcggcgcc
gaaggcaagatgcagccgaagtggcacatcctcgacgagaacgagatcgtcgacggcatc
gacgaactcggcgtactggtctacggccacgccaagaacgcctattggtacggctcgcag
ctctcgatcgaagaaacccgcgagatctgcccgtatcagaacgccaccggcatgcaggtg
tcgtcggcggtgctggccggcatggtatgggcgctggagaatccggaagccggcatcgtc
gaagccgacgagatggacttccgccgctgcctcgaagtgcagaagccgtatctcggcccg
gtgaagggctactataccgattggaccccgctcaccgaccgccccggcctgttcccggag
gacatcgacagctccgatccgtggcagttcaagaacgtcctggtgcgctga

DBGET integrated database retrieval system