KEGG   Rhodopseudomonas palustris CGA009: RPA0872Help
Entry
RPA0872           CDS       T00153                                 

Definition
peptidyl-dipeptidase Dcp
Orthology
K01284  
peptidyl-dipeptidase Dcp [EC:3.4.15.5]
Organism
rpa  Rhodopseudomonas palustris CGA009
Brite
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.5  peptidyl-dipeptidase Dcp
     RPA0872
Peptidases [BR:rpa01002]
 Metallo Peptidases
  Family M3
   RPA0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
967238..969328
Genome map
AA seq 696 aa AA seqDB search
MSESSGPIAAPADAGNPLLAAWTTPFETPPFAEIRPEHFMPAFEQAFADHAGEIAAIVND
PTEPDFDNTVTALERSGKLLNRVAAVFYDLVSAHSSPELLKIDEEVSLRMARHWNPIMMN
AVLFGRIAALRDKAARLNLTPEQSRLLERSYTRFHRAGAGLDEASKARMAAINERLAQLG
TSFSHHLLGDEQEWMMELGEGDTEGLPDSFVAAARAAAEERGLPGKAVVTLSRSSVEPFL
KMSSRRDLREKVYRAFIARGDNGNDNDNNAIIGEILSLREESAKLLGYPTFAAYRLEDSM
AKTPEAVRGLLERVWKPARARALADRDALQELVTEEGSNFKLAPWDWRYYAERLRQRRAN
FDDAAIKPYLTLDGMIAAAFDTATRLFGITFEERKDVPVWHPDVRVWEVKDADGAHRGLF
YGDYYARPSKRSGAWMTSLRDQQKLDSAVAPLIINVCNFAKGAGGEPSLLSPDDARTLFH
EFGHGLHGMLSDVTYPSLSGTSVFTDFVELPSQLYEHWQEQPQVLRQFARHYQTGEPLPD
DLLQRFIAARKFGQGFATVEFVSSALLDLEFHTQPAASIGEVRAFERKELDKIGMPEEIA
LRHRPTQFGHIFSGDHYASGYYSYMWSEVMDADAFGAFEEAGDIFAPDVAKRLRDDIYSS
GGSRDPEEAYVAFRGRKPEPDALLRRRGLLDTPEAA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagctccggaccgattgccgcacccgctgatgccggcaatccgctgctggcc
gcctggaccaccccgttcgagacaccgccgttcgccgagatcaggcccgagcacttcatg
ccggccttcgagcaggcgttcgccgaccacgcgggcgagatcgccgcgatcgtcaacgat
ccgaccgagccggacttcgacaacaccgtcacggcgctggagcgctcaggcaagctgctg
aaccgggtcgccgcggtgttctacgatctggtgtcggcgcattcgagcccggagctgctg
aagatcgacgaagaggtgtcgctgcggatggcgcggcactggaatccgatcatgatgaac
gcggtgctgttcggccggatcgcggcgctgcgcgacaaggcggcgcggctgaacctgacg
ccggagcagagccggctgctggagcgcagctacacccgcttccaccgcgccggcgccggc
ctcgacgaggcgtccaaggcacgcatggcggcgatcaacgaacgcctggcgcagctcggc
accagcttcagccatcatctgctcggcgacgagcaggaatggatgatggagctcggcgag
ggcgataccgaggggctgcccgacagcttcgtggcggcggcgcgcgctgcggcggaagag
cgcgggctgcccggcaaggccgtggtgacgctgtcgcggtcgtcggtcgagccgttcctg
aagatgtcgagccggcgcgatctgcgcgagaaggtgtaccgcgccttcatcgctcgcggc
gataacggtaacgataacgacaacaacgcgatcatcggcgagatcctgagcctgcgcgaa
gaaagcgccaagctgctcggctatccgacctttgcggcctaccgtctggaagactcgatg
gccaagacgccggaggcggtgcgcggccttttggagcgggtgtggaagccggcgcgcgct
cgcgcgctcgccgaccgcgacgcgctgcaggagctggtcacggaagagggcagcaacttc
aagctggcgccgtgggactggcgctactacgccgagaggctgcgccagcgccgcgccaat
ttcgacgatgcggcgatcaagccgtatctgacgctcgacggcatgatcgccgcggcgttc
gacaccgccacgcggttgttcggcatcaccttcgaggaacgcaaggacgtcccggtgtgg
catccggacgtccgggtgtgggaagtgaaggacgccgacggcgcgcatcgcgggctgttc
tacggcgactactatgcccggccctcgaaacgttccggcgcctggatgacctcgctgcgc
gatcagcagaagctcgacagcgcggtggcgccgctgatcatcaacgtctgcaacttcgcc
aagggcgccggcggcgagccgtcgctgctgtcgcccgacgacgcccgcacgctgttccac
gaattcggccacggcctgcacggtatgctgtcagacgtgacctacccgtcgctgtccggc
accagcgtgttcaccgacttcgtcgagctgccatcgcagctttacgagcactggcaggag
cagccgcaagtgctgcggcagttcgcccgtcactatcagaccggcgagccgctgcccgac
gatctgctgcagcggttcatcgccgcccgcaagttcggccagggcttcgccaccgtcgag
ttcgtctcctcggcgctgctcgatctcgaatttcacacccagcctgccgccagcatcggc
gaggtccgcgccttcgagcgcaaggagctcgacaagatcggcatgcccgaagagatcgcg
ctgcggcaccggccgacccagttcggccacatcttctccggcgatcactacgcctcgggc
tactacagctacatgtggagcgaggtaatggacgccgacgcgttcggcgcgttcgaagag
gccggcgacatcttcgcgccggacgtggccaagcggctgcgcgacgacatctattcgtcc
ggcggctcgcgcgatccggaggaagcctatgtggcgttccgcggccgcaagccggagccc
gacgcgctgctgcgccgccgcggcctgctcgacacgccggaggccgcgtag

DBGET integrated database retrieval system