KEGG   Rhodopseudomonas palustris CGA009: RPA0887Help
Entry
RPA0887           CDS       T00153                                 

Gene name
exoN
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPA0887 (exoN)
   00052 Galactose metabolism
    RPA0887 (exoN)
   00500 Starch and sucrose metabolism
    RPA0887 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    RPA0887 (exoN)
Enzymes [BR:rpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPA0887 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(984555..985430)
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVVDEAREAGIEHFVFVTGRNK
GMIEDHFDRQFELDVTLEKRNKKSEMEILARDQPEAGAMSFTRQQAPHGLGHAVWCARDI
VGNEPFAVVLPDELVLNTPGCLKQMIQAAEKLGDKANVIAVEEVPADKTHQYGICGVGKR
DGKMFEIDGMVEKPAPGTAPSNLSISGRYILQPEIFQILATQERGAGGEIQLTDAMIGLS
KTQKFYGVEFEGERHDCGSKAGFLRANIAFAMQRDDLRAGLIEDMKRYLEK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtcttcccggtcgccggcctcggcacccgcgttctccccgcc
accaaggcgatgccgaaggagatgctgaccatcgtcgatcgaccgctgatccagtacgtc
gtcgacgaagcgcgggaagccggcatcgagcacttcgtcttcgtcacgggacgcaacaag
ggcatgatcgaggatcacttcgaccgccagttcgagctcgatgtcacgctggagaagcgc
aacaagaagagcgagatggagatcctggcgcgcgaccagccggaggccggcgcgatgagc
ttcacccgccagcaggcaccgcacggcctcggccacgcggtgtggtgcgcccgcgacatc
gtcggcaacgagccgttcgcggtggtgctgccggacgaactggtgctcaatactccgggc
tgcctgaagcagatgatccaggccgccgagaagctcggcgacaaggccaacgtcatcgcg
gtggaggaagtgccggccgacaagacccatcaatacggcatctgcggcgtcggcaagcgc
gatggcaagatgttcgagatcgacggcatggtggagaagccggcgcccggcaccgcgccc
tcgaacctgtcgatttccgggcgctacatcctgcagccggaaatcttccagatcctggcg
acgcaggagcgcggcgccggcggcgagatccagctcaccgacgcgatgatcgggctgtcg
aagacgcagaaattctacggcgtggagttcgaaggcgagcgtcacgactgcggttcgaag
gccggcttcctgcgcgccaacatcgcgttcgcgatgcagcgcgacgacctgcgcgccggc
ctgatcgaagacatgaagcgttatctggagaagtga

DBGET integrated database retrieval system