KEGG   Rhodopseudomonas palustris CGA009: RPA0888Help
Entry
RPA0888           CDS       T00153                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rpa00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(985554..986600)
Genome map
AA seq 348 aa AA seqDB search
MGGVFRGSRGGPKLFAPAAFIQIFQAFSPLRTRSMTLVSTPANPVPEDAVSGFIKTPDGV
QLRFARWEPPGHRKGTVCVFTGRTEQIEKYFETVRDLRDRGFAVAALDWRGQGHSERRLR
DYRKGYVRNFADFEVDVETFVREVVLPDCPPPHFALAHSMGGAVMLRIARSGKRWFDRMV
LSAPMIDLAGNTTALPIRLLLRAMRLAGQGGRYVPGGNDVLANTEPFVGNKLTSDPVRYA
RNAAIVAEDPTLGLASPTVAWADTAFRAMHAFKATNYPSQIRQPILMIAAGMDGVVSTPA
IEEFAYHLRAGSHLVIPGAKHEILQEQDRYRQQFWAAFDAFVPGTPLF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggaggggtgtttcggggttcaagagggggcccgaagctgttcgcgcccgccgctttc
atccagattttccaggcattttctcccctccggactcggtccatgacgctcgtctcgact
cctgccaatccggtgcccgaagacgccgtctccggcttcatcaagacgcccgacggcgtg
caactccgctttgcgcgatgggagccgccggggcaccgcaaaggcaccgtatgcgtcttc
accggacgcaccgaacagatcgagaagtacttcgagacggtgcgcgatctgcgcgatcgc
ggctttgcagtcgcggcgctcgactggcgcggccagggccattcggagcgccggctgcgc
gactatcgcaagggctatgtgcgcaacttcgccgacttcgaggtcgacgtcgaaaccttc
gtgcgtgaagtcgtgctgccggactgcccgccgccgcatttcgcactggcgcattcgatg
ggcggggcggtgatgctgcggatcgcccgctccggcaagcgctggttcgaccgcatggtg
ctgtcggccccgatgatcgaccttgcgggcaacaccaccgcgctgccgatcaggctattg
ctgcgggcgatgcggctggccggccaaggcggccgttacgttcccggcggcaacgacgtg
ctcgccaacaccgagccgttcgtcggaaacaagctgacctcggatccggtacgctacgcc
cgcaacgccgcaatcgtcgccgaagatccgaccctgggcctcgcctcgccgaccgtcgcc
tgggctgacaccgctttccgcgccatgcacgccttcaaggcgaccaactatccgtcgcaa
atccggcagccgatcctgatgatcgcggccggtatggacggcgtggtgtcgacgccggcg
atcgaagagttcgcttatcatttgcgggccggctcgcatctggtgatccccggcgccaag
cacgaaatcctccaggagcaggatcgctaccgccagcaattctgggcggcgttcgatgct
ttcgtaccggggacgccgcttttctga

DBGET integrated database retrieval system