KEGG   Rhodopseudomonas palustris CGA009: RPA1039Help
Entry
RPA1039           CDS       T00153                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rpa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1142869..1143768
Genome map
AA seq 299 aa AA seqDB search
MTDGSAMTLRDEARAKVNLTLRVVGRRPDGYHELESVVAFADCADHLTLQPGAALSLTTI
GPGAQDCGDSADNLVLKAARLLGERVPDLTTGAFTLDKHLPVAAGIGGGSADAAAALRLL
ARANDLAVDDPRLIEAARLTGADVPVCLPSKPCVMTGVGEKLSPLPLPRIPAVMVNPRVP
VATKDVFTALGLKPGSLAVGATDVLAAPAWPEAGAPLADWVVALEAGTNDLEPPALKVEP
VVGTVLEALRATAGVQLARMSGSGATCFALYADDASARAAADALCAAHPGWWVHAGSLS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacggctctgcgatgacactgcgcgacgaggcgcgcgccaaggtgaacctgacg
ctgcgtgtagtcggccgtcgccccgacggctaccacgagctggaaagcgtggtggcgttc
gccgattgcgccgatcacctgaccctgcagcccggcgcagcgctgagcctgaccacgatc
ggccccggcgctcaggattgcggcgacagcgccgacaatctggtgctgaaggctgcgcgg
ctgctcggtgagcgggtgccggacctgacgaccggcgccttcaccctcgacaagcatctg
ccggtggcggccggcatcggcggcggctcggccgacgctgccgcagcgctgcggctgctc
gcccgcgccaatgatcttgccgtcgatgatccgcgcctgattgaagccgcccggctgacc
ggcgcggatgttccggtgtgcctgccgtcgaagccgtgtgtgatgaccggtgtcggcgag
aagctgtcgccgctgccgctgccgcggatcccggccgtgatggtcaatccgcgggtaccg
gtggccaccaaggacgtgttcaccgcgctcggtctgaagcccggctcgctcgcagtcggc
gccactgacgtcctcgctgcaccggcttggccggaagccggcgcgccgctcgccgattgg
gtcgtggcgctcgaggccggcaccaacgatctcgaaccgccggccctcaaggtcgagccg
gtggtcggcaccgtgctggaggcgctgcgcgcgaccgccggtgtgcagctcgcccggatg
tccggctcgggcgcgacctgctttgcgctgtatgccgatgacgcctcggcccgcgccgcc
gcagacgcgctctgcgccgcgcatcccggctggtgggtccacgccggcagcctgagctga

DBGET integrated database retrieval system