KEGG   Rhodopseudomonas palustris CGA009: RPA1100Help
Entry
RPA1100           CDS       T00153                                 

Gene name
ruvA
Definition
(GenBank) RuvA; Holliday branch migration protein
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPA1100 (ruvA)
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RPA1100 (ruvA)
DNA repair and recombination proteins [BR:rpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RPA1100 (ruvA)
    RecFOR pathway proteins
     RPA1100 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH
Motif
Other DBs
NCBI-ProteinID: CAE26543
CyanoBase: RPA1100
CYORF: RPA1100
UniProt: Q6NAT0
Position
1205358..1205975
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGIIDSYGEDYVILDVQGVGYQVHCASRTLQALPSPGEAATLSIETYVREDQIKL
FGFRTDTEREWFRLLQTVQSVGAKVALAVLSTLPPHDLANAIALRDKAAVARTPGVGPKV
AERIVTELKDKVPALSAVDPAVVKLSGAIDDNRAPRAVADAISALVNLGYGQPQAAAAVA
TASRTAGEDAETAQLIKLGLKELSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggcatcattgacagctatggcgaggattacgtgatcctcgac
gtgcagggcgtcggctatcaggtgcactgcgccagccgcaccctgcaggcgctgccgtcg
ccgggtgaggcggcgacgctgtcgatcgaaacctatgtgcgcgaagaccagatcaagctg
ttcggtttccgcaccgatactgagcgggagtggttccggctgctgcagacggtgcagagc
gtcggcgccaaggtggcgctggcggtgctctcgacattgccgccgcatgacctcgccaat
gcgattgcgctacgcgacaaggcggcggtggcgcgcaccccgggcgtcggcccgaaggtg
gccgagcgcatcgtcaccgaactgaaggacaaggtaccggcgctaagtgcggtcgatccg
gcggtggtgaagctctccggcgcgatcgacgacaatcgggcgccgcgcgcagtggcggat
gcgatttcggcgctcgttaatctcggctatggccagccgcaggcggcggcagcggttgcc
acagcctcccgcactgccggtgaggacgccgagacggcgcagctgatcaagctcggtttg
aaggagctgtcgaagtga

DBGET integrated database retrieval system