KEGG   Rhodopseudomonas palustris CGA009: RPA1100Help
Entry
RPA1100           CDS       T00153                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPA1100 (ruvA)
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RPA1100 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1205358..1205975
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGIIDSYGEDYVILDVQGVGYQVHCASRTLQALPSPGEAATLSIETYVREDQIKL
FGFRTDTEREWFRLLQTVQSVGAKVALAVLSTLPPHDLANAIALRDKAAVARTPGVGPKV
AERIVTELKDKVPALSAVDPAVVKLSGAIDDNRAPRAVADAISALVNLGYGQPQAAAAVA
TASRTAGEDAETAQLIKLGLKELSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggcatcattgacagctatggcgaggattacgtgatcctcgac
gtgcagggcgtcggctatcaggtgcactgcgccagccgcaccctgcaggcgctgccgtcg
ccgggtgaggcggcgacgctgtcgatcgaaacctatgtgcgcgaagaccagatcaagctg
ttcggtttccgcaccgatactgagcgggagtggttccggctgctgcagacggtgcagagc
gtcggcgccaaggtggcgctggcggtgctctcgacattgccgccgcatgacctcgccaat
gcgattgcgctacgcgacaaggcggcggtggcgcgcaccccgggcgtcggcccgaaggtg
gccgagcgcatcgtcaccgaactgaaggacaaggtaccggcgctaagtgcggtcgatccg
gcggtggtgaagctctccggcgcgatcgacgacaatcgggcgccgcgcgcagtggcggat
gcgatttcggcgctcgttaatctcggctatggccagccgcaggcggcggcagcggttgcc
acagcctcccgcactgccggtgaggacgccgagacggcgcagctgatcaagctcggtttg
aaggagctgtcgaagtga

DBGET integrated database retrieval system