KEGG   Rhodopseudomonas palustris CGA009: RPA1506Help
Entry
RPA1506           CDS       T00153                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPA1506 (bchI)
Enzymes [BR:rpa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPA1506 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1672126..1673148
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQEEMKLALLIAAVDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKTVV
GCRYNCDPDQPDRYCEECKEKVKHGKVKTAQVPVPVVDLPLGATEDRVVGALDLERALAK
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDTLPERIEVVRRRDAFENDPAAFVADWSKEEA
KLRRKISQAKERLPEVTVSDAALERAAKLCMTLGTDGLRGELTLMRAARALAALEHDKTV
TDEHLKRIAPSALRHRLRRNPLDDAGSSVRVDRALAEIFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgtttccgttctccgcgatcgtcggccaggaagagatgaagctggctctg
ctgatcgcagctgtcgatcagaaggtcggcggcgtgctggcgttcggcgatcgcggcgcc
ggcaagtcgaccgccgtgcgcgctctcgcagcgctgctgccaaagatgaagaccgtggtc
ggttgccgctacaattgcgatcccgatcagcccgatcgttactgcgaagagtgcaaggaa
aaggtcaaacacggcaaggtcaagaccgcgcaggtgccggtgccggtggtcgatctgccg
ctcggcgcgaccgaagaccgcgtcgtcggcgcgctcgacctggagcgtgcgctcgccaag
ggcgagaaggcgtttgagcctggcctgctggcgcgggcacatcgcggcttcctgtacatc
gacgaagccaacctgctggaagaccatctggtcgacctgctgctcgacgtcgccgcctcc
ggcgagaacgtggtcgagcgtgaaggcctcagcattcggcacccggcgcggttcgtgctg
gtcggcactggcaaccccgaagagggcgaactgcgcccgcagttgcttgaccgcttcggc
atgtcggtggaagtgaagacgccggacacgctgccggagcgcatcgaagtggtgcgccgc
cgtgatgcgttcgagaacgatcctgccgccttcgtggccgattggtcaaaggaagaggcc
aagctgcgccgcaagatttcgcaggccaaggaacggctgcccgaagtcaccgtgagcgac
gcggcgctggagcgtgccgccaagctgtgtatgacgctcggcaccgacggcctgcgcggc
gaactgaccttgatgcgcgccgcgcgtgcgctcgctgcgctcgagcacgacaagaccgtg
accgatgaacacctgaagcggatcgcgccctctgccttgcggcaccggttgcgccgcaat
ccgctcgacgatgccggctctagcgtgcgtgtcgaccgcgcgctcgccgaaatcttcgga
tga

DBGET integrated database retrieval system