KEGG   Rhodopseudomonas palustris CGA009: RPA1506Help
Entry
RPA1506           CDS       T00153                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1672126..1673148
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQEEMKLALLIAAVDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKTVV
GCRYNCDPDQPDRYCEECKEKVKHGKVKTAQVPVPVVDLPLGATEDRVVGALDLERALAK
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDTLPERIEVVRRRDAFENDPAAFVADWSKEEA
KLRRKISQAKERLPEVTVSDAALERAAKLCMTLGTDGLRGELTLMRAARALAALEHDKTV
TDEHLKRIAPSALRHRLRRNPLDDAGSSVRVDRALAEIFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgtttccgttctccgcgatcgtcggccaggaagagatgaagctggctctg
ctgatcgcagctgtcgatcagaaggtcggcggcgtgctggcgttcggcgatcgcggcgcc
ggcaagtcgaccgccgtgcgcgctctcgcagcgctgctgccaaagatgaagaccgtggtc
ggttgccgctacaattgcgatcccgatcagcccgatcgttactgcgaagagtgcaaggaa
aaggtcaaacacggcaaggtcaagaccgcgcaggtgccggtgccggtggtcgatctgccg
ctcggcgcgaccgaagaccgcgtcgtcggcgcgctcgacctggagcgtgcgctcgccaag
ggcgagaaggcgtttgagcctggcctgctggcgcgggcacatcgcggcttcctgtacatc
gacgaagccaacctgctggaagaccatctggtcgacctgctgctcgacgtcgccgcctcc
ggcgagaacgtggtcgagcgtgaaggcctcagcattcggcacccggcgcggttcgtgctg
gtcggcactggcaaccccgaagagggcgaactgcgcccgcagttgcttgaccgcttcggc
atgtcggtggaagtgaagacgccggacacgctgccggagcgcatcgaagtggtgcgccgc
cgtgatgcgttcgagaacgatcctgccgccttcgtggccgattggtcaaaggaagaggcc
aagctgcgccgcaagatttcgcaggccaaggaacggctgcccgaagtcaccgtgagcgac
gcggcgctggagcgtgccgccaagctgtgtatgacgctcggcaccgacggcctgcgcggc
gaactgaccttgatgcgcgccgcgcgtgcgctcgctgcgctcgagcacgacaagaccgtg
accgatgaacacctgaagcggatcgcgccctctgccttgcggcaccggttgcgccgcaat
ccgctcgacgatgccggctctagcgtgcgtgtcgaccgcgcgctcgccgaaatcttcgga
tga

DBGET integrated database retrieval system